(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE24

ALDEN1_2.PE24        Location/Qualifiers
FT   CDS             complement(31168..32355)
FT                   /locus_tag="Alide_0024"
FT                   /gene_family="HOG000131668" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: bpt:Bpet3281 acyl-CoA dehydrogenase"
FT                   /db_xref="GI:319760762"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102047"
FT                   /translation="MQVGYPAEDEAFRLTLREWFETHYPRFKAGWPVQPDPNELAWRRA
FT                   WEDYVCRAGWSGLGWPLEYGGKAWPLTRQAIFHEEQARIGAPLGVNIIGHGILAPTLIH
FT                   FASAAQKARYLPGILANRDIWCQGYSEPGAGSDLAALATRAERRGDHYVLNGHKIWTSF
FT                   AHIADHCFVLARTDPGAQRHKGISFLLVDMKSPGVRVEPIRQITGEADFNEVFFEDVRV
FT                   PLDALVGEENGGWRLAMAAASFERGTYFIPRQVRFAQEVEALARLAAGISREGGESALQ
FT                   DPHLRREIARLAVDSHVLRLKGLRALTHALRGGPPGAEGSSAKLHWSEAHQKMMSIAME
FT                   LLGERTLQGPGPAGADPAAALWARDYLWTRAETILAGTSEVQRNILAEQMLGLPR"
FT                   /protein_id="YP_004124699.1"
     MQVGYPAEDE AFRLTLREWF ETHYPRFKAG WPVQPDPNEL AWRRAWEDYV CRAGWSGLGW        60
     PLEYGGKAWP LTRQAIFHEE QARIGAPLGV NIIGHGILAP TLIHFASAAQ KARYLPGILA       120
     NRDIWCQGYS EPGAGSDLAA LATRAERRGD HYVLNGHKIW TSFAHIADHC FVLARTDPGA       180
     QRHKGISFLL VDMKSPGVRV EPIRQITGEA DFNEVFFEDV RVPLDALVGE ENGGWRLAMA       240
     AASFERGTYF IPRQVRFAQE VEALARLAAG ISREGGESAL QDPHLRREIA RLAVDSHVLR       300
     LKGLRALTHA LRGGPPGAEG SSAKLHWSEA HQKMMSIAME LLGERTLQGP GPAGADPAAA       360
     LWARDYLWTR AETILAGTSE VQRNILAEQM LGLPR                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page