(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE240

ALDEN1_2.PE240       Location/Qualifiers
FT   CDS             complement(268520..268834)
FT                   /locus_tag="Alide_0244"
FT                   /gene_family="HOG000140892" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05284"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF736; KEGG:
FT                   aav:Aave_0681 hypothetical protein"
FT                   /db_xref="GI:319760978"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="GeneID:10102267"
FT                   /translation="MANIGTFTADKDGFNGQLRTLTLNVKVKLVPNDKGNNESAPDFRL
FT                   QAAGHDIGAAWKKTSEAGRPYVSVTLDDPSFPATVYARLIENEDGTHDLIWSRNKPKAA
FT                   "
FT                   /protein_id="YP_004124915.1"
     MANIGTFTAD KDGFNGQLRT LTLNVKVKLV PNDKGNNESA PDFRLQAAGH DIGAAWKKTS        60
     EAGRPYVSVT LDDPSFPATV YARLIENEDG THDLIWSRNK PKAA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page