(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE241

ALDEN1_2.PE241       Location/Qualifiers
FT   CDS             269905..270819
FT                   /locus_tag="Alide_0245"
FT                   /gene_family="HOG000219404" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RPC_3544"
FT                   /codon_start="1"
FT                   /product="phage associated protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpc:RPC_3544 phage associated protein"
FT                   /db_xref="GI:319760979"
FT                   /db_xref="GeneID:10102268"
FT                   /translation="MTIRESGADSTWHRAKEIVEAQGNDAQFVNISQNIASKLAVAQAN
FT                   RTIPGGIVVVIEGTCGNPAKSFMCVIKAEPHGGFTKRQAGGHLTLEYIKELILTPQAKL
FT                   YKIGAFLRQDPAAATPQEPTTGWRAFLFDDLITQGNKLAAAQYFYESFLGLEFPSNSAF
FT                   QTKQFHALTKDFIRNANVDSEKKIDLLNALTTYLKTDQAATIQVDVFSQNYLGDAALQD
FT                   AYTAYMGQKSFPNTAIHKDLSEVQSQLRLRKLTFGHDIKLTAPADQFENYVRIESIDGD
FT                   ADEHGNVPKWTKITVRDHIRDQE"
FT                   /protein_id="YP_004124916.1"
     MTIRESGADS TWHRAKEIVE AQGNDAQFVN ISQNIASKLA VAQANRTIPG GIVVVIEGTC        60
     GNPAKSFMCV IKAEPHGGFT KRQAGGHLTL EYIKELILTP QAKLYKIGAF LRQDPAAATP       120
     QEPTTGWRAF LFDDLITQGN KLAAAQYFYE SFLGLEFPSN SAFQTKQFHA LTKDFIRNAN       180
     VDSEKKIDLL NALTTYLKTD QAATIQVDVF SQNYLGDAAL QDAYTAYMGQ KSFPNTAIHK       240
     DLSEVQSQLR LRKLTFGHDI KLTAPADQFE NYVRIESIDG DADEHGNVPK WTKITVRDHI       300
     RDQE                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page