(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE242

ALDEN1_2.PE242       Location/Qualifiers
FT   CDS             270960..271802
FT                   /locus_tag="Alide_0246"
FT                   /gene_family="HOG000219405" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04607"
FT                   /codon_start="1"
FT                   /product="rela/spot domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: rpc:RPC_3545
FT                   RelA/SpoT"
FT                   /db_xref="GI:319760980"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="GeneID:10102269"
FT                   /translation="MVPRLKGDTSLIDKALYRSKPYKNPYEDITDKVGMRYVVLLTTHI
FT                   NTFCSIIESRECEAFWSWSKDKDYEEERLAKPLEFSYQSVHYVLRSKAELSVDGVNLPE
FT                   GLACEVQIRTLLQHAHSELTHDTLYKPKTTAKPSIKRTVAKSMALIEATDEFFEQAMKD
FT                   LASASEPQRQLLDYLSTTYRKGTGLEPGQERSNQLVVDAFMEFLPQETSARIEEFLTAK
FT                   NYIFEKIKEQNGQRHFFNQPAVLLAYFLVEKMPAQTRENWPIDSDDLAKIFSDLGAAF"
FT                   /protein_id="YP_004124917.1"
     MVPRLKGDTS LIDKALYRSK PYKNPYEDIT DKVGMRYVVL LTTHINTFCS IIESRECEAF        60
     WSWSKDKDYE EERLAKPLEF SYQSVHYVLR SKAELSVDGV NLPEGLACEV QIRTLLQHAH       120
     SELTHDTLYK PKTTAKPSIK RTVAKSMALI EATDEFFEQA MKDLASASEP QRQLLDYLST       180
     TYRKGTGLEP GQERSNQLVV DAFMEFLPQE TSARIEEFLT AKNYIFEKIK EQNGQRHFFN       240
     QPAVLLAYFL VEKMPAQTRE NWPIDSDDLA KIFSDLGAAF                             280
//

If you have problems or comments...

PBIL Back to PBIL home page