(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE244

ALDEN1_2.PE244       Location/Qualifiers
FT   CDS             complement(272208..274262)
FT                   /locus_tag="Alide_0248"
FT                   /gene_family="HOG000222687" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02195"
FT                   /codon_start="1"
FT                   /product="parb domain protein nuclease"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_3534 ParB domain protein nuclease;
FT                   PFAM: ParB domain protein nuclease; SMART: ParB domain
FT                   protein nuclease"
FT                   /db_xref="GI:319760982"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="GeneID:10102271"
FT                   /translation="MNAITQTEARAVNTAAAIPLEAADPTKNLILVPLSRLVLRPTGRN
FT                   VRKTPRMSIPELAASIRRVGLLQNLIVIASADGEHYEVVAGGRRLAALKLLAKKHRISK
FT                   EWEVPCLLVADGTARTASLTENVQREAMHPADQFEAFAALVAEGRPIEDIAADFSVTPL
FT                   VVQRRLKLANVSPRLMADYRADAVSLDQLMALAITDDHAAQESAFYDAPTWQRHPSNLR
FT                   ERLTEREIDAYRHPLVRFVGLDVYEQAGGRVRRDLFAEGDAGVYLTDAALLERLVQDKL
FT                   AGIAAETKAEGWAWVDAAPAATYADLQAFQRAPRERREPNKREAQRIEKLQAKMQEVAE
FT                   AVDAAMDADDENKADALQEEGETLGEQLQALEDGLQDYSPNVKAAAGAIVTIDRNGEAI
FT                   IHRGLMREAEAKALRTLERLRQGFSGEDAENDDEGEDDEQPKTAAMPDRLAQRLSAHRT
FT                   AALQIEVARHPQVALAAVVHGMVQTVLQESRYGHDLPLGVGLKVQDRLEGMAPDWPESP
FT                   AAVALRELQQVAGEGLPEDSAALFAALLAKPQDELVRLLAVCVASTVDVVTPRATPHQP
FT                   GAELAQAVGLDMAAWWQPTAEGYFKHVSKAVILDAVGAFAPESVTRLAKLKKADIASEA
FT                   ERLADGKGWMPAIFKATGPQDVAQEAGPEQDAPEDAEAMADEPAEALAA"
FT                   /protein_id="YP_004124919.1"
     MNAITQTEAR AVNTAAAIPL EAADPTKNLI LVPLSRLVLR PTGRNVRKTP RMSIPELAAS        60
     IRRVGLLQNL IVIASADGEH YEVVAGGRRL AALKLLAKKH RISKEWEVPC LLVADGTART       120
     ASLTENVQRE AMHPADQFEA FAALVAEGRP IEDIAADFSV TPLVVQRRLK LANVSPRLMA       180
     DYRADAVSLD QLMALAITDD HAAQESAFYD APTWQRHPSN LRERLTEREI DAYRHPLVRF       240
     VGLDVYEQAG GRVRRDLFAE GDAGVYLTDA ALLERLVQDK LAGIAAETKA EGWAWVDAAP       300
     AATYADLQAF QRAPRERREP NKREAQRIEK LQAKMQEVAE AVDAAMDADD ENKADALQEE       360
     GETLGEQLQA LEDGLQDYSP NVKAAAGAIV TIDRNGEAII HRGLMREAEA KALRTLERLR       420
     QGFSGEDAEN DDEGEDDEQP KTAAMPDRLA QRLSAHRTAA LQIEVARHPQ VALAAVVHGM       480
     VQTVLQESRY GHDLPLGVGL KVQDRLEGMA PDWPESPAAV ALRELQQVAG EGLPEDSAAL       540
     FAALLAKPQD ELVRLLAVCV ASTVDVVTPR ATPHQPGAEL AQAVGLDMAA WWQPTAEGYF       600
     KHVSKAVILD AVGAFAPESV TRLAKLKKAD IASEAERLAD GKGWMPAIFK ATGPQDVAQE       660
     AGPEQDAPED AEAMADEPAE ALAA                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page