(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE248

ALDEN1_2.PE248       Location/Qualifiers
FT   CDS             276730..277758
FT                   /locus_tag="Alide_0252"
FT                   /gene_family="HOG000050991" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rmet_1473"
FT                   /codon_start="1"
FT                   /product="retron reverse transcriptase"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_1473 retron reverse transcriptase"
FT                   /db_xref="GI:319760986"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="GeneID:10102275"
FT                   /translation="MDLYPIKPRYRSNPVKSIAALARGLRWDAQSLVELADRANGMWRT
FT                   VKPKPGSTRQTFDAMGQLKEIHQRLKLNVFSKVDFPEYLQGSLKGRDYVTNASIHKGKQ
FT                   ILICEDVKGFFPSVSAAFVEDVWCGFFRFSPDVAKLLTRLTTKDGYLPQGAITSSFLAN
FT                   LVMWRYEPWLHAKFAQRGITYSRYVDDMAMSSATHLDKETQTWIIAQVYGMLAQHGLKA
FT                   SRKKHEVFSASQPMIATKLTVNRKPSLSPKKQSKVRTRVRQLEIAATSGASTDELRELA
FT                   NKAAQQVGQLGRFHKTPAAKLKSRIAVVRDNLSPEALSVTTAPAKVRLDTVPLVTDARP
FT                   WE"
FT                   /protein_id="YP_004124923.1"
     MDLYPIKPRY RSNPVKSIAA LARGLRWDAQ SLVELADRAN GMWRTVKPKP GSTRQTFDAM        60
     GQLKEIHQRL KLNVFSKVDF PEYLQGSLKG RDYVTNASIH KGKQILICED VKGFFPSVSA       120
     AFVEDVWCGF FRFSPDVAKL LTRLTTKDGY LPQGAITSSF LANLVMWRYE PWLHAKFAQR       180
     GITYSRYVDD MAMSSATHLD KETQTWIIAQ VYGMLAQHGL KASRKKHEVF SASQPMIATK       240
     LTVNRKPSLS PKKQSKVRTR VRQLEIAATS GASTDELREL ANKAAQQVGQ LGRFHKTPAA       300
     KLKSRIAVVR DNLSPEALSV TTAPAKVRLD TVPLVTDARP WE                          342
//

If you have problems or comments...

PBIL Back to PBIL home page