(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE250

ALDEN1_2.PE250       Location/Qualifiers
FT   CDS             complement(278244..278573)
FT                   /locus_tag="Alide_0254"
FT                   /gene_family="HOG000139378" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02683"
FT                   /codon_start="1"
FT                   /product="addiction module killer protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpr:GBP346_A0938 probable addiction module
FT                   killer protein; TIGRFAM: addiction module killer protein;
FT                   PFAM: protein of unknown function DUF891"
FT                   /db_xref="GI:319760988"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="GeneID:10102277"
FT                   /translation="MYRIEHYLTVDEQKDVYDDWLRRLRDAQAKVAVIRRVTRVEQGNF
FT                   GDHKFCRDGVWELRIDAGPGYRVYYGLAGHRLVLLLCGGDKRTQDADIARAVAYWQDWQ
FT                   QRGDE"
FT                   /protein_id="YP_004124925.1"
     MYRIEHYLTV DEQKDVYDDW LRRLRDAQAK VAVIRRVTRV EQGNFGDHKF CRDGVWELRI        60
     DAGPGYRVYY GLAGHRLVLL LCGGDKRTQD ADIARAVAYW QDWQQRGDE                   109
//

If you have problems or comments...

PBIL Back to PBIL home page