(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE254

ALDEN1_2.PE254       Location/Qualifiers
FT   CDS             285725..286441
FT                   /locus_tag="Alide_0258"
FT                   /gene_family="HOG000220583" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0152"
FT                   /codon_start="1"
FT                   /product="17 kda surface antigen"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0152 17 kDa surface antigen"
FT                   /db_xref="GI:319760992"
FT                   /db_xref="GeneID:10102281"
FT                   /translation="MNPATSSQPAASVKWLWAAVGALGVSVLALGGTLLAQNLRGDASP
FT                   AAQATAAALRTPESEIIDEKAPQGQAQQALAATDSRAVQSRRAPMPQADSYLQPAAQSR
FT                   PAAPVCASCGRVESVQAIEQAAPATGLGAVAGGVLGGVLGNQIGKGSGRTAATVLGAVG
FT                   GGYVGHKVEERTRTTTVYQMRVRMQDGSVRSFTRSQPVAEGTPVRVQGKGFRVDDGSGD
FT                   ADRAGTQPVRVVDRGY"
FT                   /protein_id="YP_004124929.1"
     MNPATSSQPA ASVKWLWAAV GALGVSVLAL GGTLLAQNLR GDASPAAQAT AAALRTPESE        60
     IIDEKAPQGQ AQQALAATDS RAVQSRRAPM PQADSYLQPA AQSRPAAPVC ASCGRVESVQ       120
     AIEQAAPATG LGAVAGGVLG GVLGNQIGKG SGRTAATVLG AVGGGYVGHK VEERTRTTTV       180
     YQMRVRMQDG SVRSFTRSQP VAEGTPVRVQ GKGFRVDDGS GDADRAGTQP VRVVDRGY         238
//

If you have problems or comments...

PBIL Back to PBIL home page