(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE255

ALDEN1_2.PE255       Location/Qualifiers
FT   CDS             complement(286498..287271)
FT                   /locus_tag="Alide_0259"
FT                   /gene_family="HOG000265759" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.18.1.2"
FT                   /codon_start="1"
FT                   /EC_number="1.18.1.2"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0153 ferredoxin--NADP(+) reductase;
FT                   PFAM: oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   Oxidoreductase FAD-binding domain protein"
FT                   /db_xref="GI:319760993"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="GeneID:10102282"
FT                   /translation="MSAFHEERVLSVHHWTDRLFSFTTTRDPALRFSNGHFTMIGLKVN
FT                   DKPLLRAYSIVSANYEEHLEFLSIKVPDGPLTSRLQHIKVGDSIIVGKKPTGTLLIDYL
FT                   LPAKRLYLMSTGTGLAPFLSVIRDPETYEKFEEVVLIHGVRQVAELAYHDYITRELPKH
FT                   EFLGELVTKQLKYYPTVTREPFRNQGRIPNLIESGKLFTDLGVPPLDPLTDRAMLCGSP
FT                   EMLASLKTILEHRDFEEGNTTRPGDFVIERAFVEK"
FT                   /product="ferredoxin--nadp(+) reductase"
FT                   /protein_id="YP_004124930.1"
     MSAFHEERVL SVHHWTDRLF SFTTTRDPAL RFSNGHFTMI GLKVNDKPLL RAYSIVSANY        60
     EEHLEFLSIK VPDGPLTSRL QHIKVGDSII VGKKPTGTLL IDYLLPAKRL YLMSTGTGLA       120
     PFLSVIRDPE TYEKFEEVVL IHGVRQVAEL AYHDYITREL PKHEFLGELV TKQLKYYPTV       180
     TREPFRNQGR IPNLIESGKL FTDLGVPPLD PLTDRAMLCG SPEMLASLKT ILEHRDFEEG       240
     NTTRPGDFVI ERAFVEK                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page