(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE257

ALDEN1_2.PE257       Location/Qualifiers
FT   CDS             288677..290575
FT                   /locus_tag="Alide_0261"
FT                   /gene_family="HOG000228780" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ajs:Ajs_0155 inner-membrane translocator"
FT                   /db_xref="GI:319760995"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:10102284"
FT                   /translation="MDFSGLLAQLLNGLAGASTLFLVAAGLSLIFGVTRIVNFAHGSFY
FT                   MLGLFAAYSCVEQLAGAIGFWPALLLAPLAVGLLGALVELLLLRRIYHASELLQLLATF
FT                   ALVLVIKDAALWLWGPEELFGPRAPGLAGAVDLLGRRFPAYDLFLIAVGPLVLVLLTLL
FT                   LTRTRWGTLVRAATQDREMVGALGVNQAWLFTGVFALGALLAGLGGALQLPREPASLEL
FT                   DMLTIGAAFVVVVVGGMGSIPGAFVAALLIAELKAVCIWLGVVQVGGVAVAFPKLTLVV
FT                   EFLVMALVLVWRPWGLMGRPQAAVRAPGAPEALLHGAGARAAAAWAALLVALALLPLAA
FT                   GQEGYATVLLTDVAIAALFAASLHFILGPGGMHSFGHAAYFGLGAYGAALLVRWLDLPM
FT                   GAALLLGPLAAAAGALVYGWFCVRLSGVYLAMLTLAFAQITWAVAFQWDGLTGGSNGLT
FT                   GIWPPEWAAQGAAFYWLALALAAAGVYLLRRMLFAPLGWALRAARDSAPRAEAIGIHVR
FT                   RVQWAAFVVAGLLAGLAGALFAFSKGGVAPDALWVGKSVDGLVMVLLGGVQQLAGPLVG
FT                   AAAFTWLHDSVARATDYWRALLGGTMLVLVLLFPQGISGFAQYWQAKTALKKGVAA"
FT                   /protein_id="YP_004124932.1"
     MDFSGLLAQL LNGLAGASTL FLVAAGLSLI FGVTRIVNFA HGSFYMLGLF AAYSCVEQLA        60
     GAIGFWPALL LAPLAVGLLG ALVELLLLRR IYHASELLQL LATFALVLVI KDAALWLWGP       120
     EELFGPRAPG LAGAVDLLGR RFPAYDLFLI AVGPLVLVLL TLLLTRTRWG TLVRAATQDR       180
     EMVGALGVNQ AWLFTGVFAL GALLAGLGGA LQLPREPASL ELDMLTIGAA FVVVVVGGMG       240
     SIPGAFVAAL LIAELKAVCI WLGVVQVGGV AVAFPKLTLV VEFLVMALVL VWRPWGLMGR       300
     PQAAVRAPGA PEALLHGAGA RAAAAWAALL VALALLPLAA GQEGYATVLL TDVAIAALFA       360
     ASLHFILGPG GMHSFGHAAY FGLGAYGAAL LVRWLDLPMG AALLLGPLAA AAGALVYGWF       420
     CVRLSGVYLA MLTLAFAQIT WAVAFQWDGL TGGSNGLTGI WPPEWAAQGA AFYWLALALA       480
     AAGVYLLRRM LFAPLGWALR AARDSAPRAE AIGIHVRRVQ WAAFVVAGLL AGLAGALFAF       540
     SKGGVAPDAL WVGKSVDGLV MVLLGGVQQL AGPLVGAAAF TWLHDSVARA TDYWRALLGG       600
     TMLVLVLLFP QGISGFAQYW QAKTALKKGV AA                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page