(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE258

ALDEN1_2.PE258       Location/Qualifiers
FT   CDS             290572..292110
FT                   /locus_tag="Alide_0262"
FT                   /gene_family="HOG000229903" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="abc transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_0860 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:319760996"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:10102285"
FT                   /translation="MTLLRVENLRKSFGGVQAVQGVSFALAAGELLALIGPNGAGKSTT
FT                   FNMVDGQLAPDGGRVLLDGQDITGLSPRAIWRRGVGRTFQIAQTFASFSVLQNVQLALL
FT                   SHDRKAWRWWRRADAHRPQDALALLEQVGMAAQAHRPCSELAYGDVKRVELAMALAHAP
FT                   RLLLMDEPTAGMAPAERLALMRLVQRLARERRMAVLFTEHSMDVVFGQADRVAVLVRGQ
FT                   LLAEGTPDAIRQDERVQQVYLGQGLQDFEKNSCQRPPAKGSGPKTPEMPGAPLLQMQDL
FT                   DAWYGAAHILHGVSLAVGRGEVVALMGRNGAGKSTTLKSIAGLLQRRSGRMAFMGRRID
FT                   TLAPHQIARLGLGYVPEDRRIFTDLTVLENLEAGRQPPRHWPGGQPVPHWTPQRLFALF
FT                   PNLGEMPNRPGGRMSGGEQQMLTVARTLMGQPCLVLLDEPSEGVAPVIVEQMARTILAL
FT                   KAQGMGILLSEQNLPFAQAVADRAYVLEQGRIVHEAPMAELARDVQARKQYLGV"
FT                   /protein_id="YP_004124933.1"
     MTLLRVENLR KSFGGVQAVQ GVSFALAAGE LLALIGPNGA GKSTTFNMVD GQLAPDGGRV        60
     LLDGQDITGL SPRAIWRRGV GRTFQIAQTF ASFSVLQNVQ LALLSHDRKA WRWWRRADAH       120
     RPQDALALLE QVGMAAQAHR PCSELAYGDV KRVELAMALA HAPRLLLMDE PTAGMAPAER       180
     LALMRLVQRL ARERRMAVLF TEHSMDVVFG QADRVAVLVR GQLLAEGTPD AIRQDERVQQ       240
     VYLGQGLQDF EKNSCQRPPA KGSGPKTPEM PGAPLLQMQD LDAWYGAAHI LHGVSLAVGR       300
     GEVVALMGRN GAGKSTTLKS IAGLLQRRSG RMAFMGRRID TLAPHQIARL GLGYVPEDRR       360
     IFTDLTVLEN LEAGRQPPRH WPGGQPVPHW TPQRLFALFP NLGEMPNRPG GRMSGGEQQM       420
     LTVARTLMGQ PCLVLLDEPS EGVAPVIVEQ MARTILALKA QGMGILLSEQ NLPFAQAVAD       480
     RAYVLEQGRI VHEAPMAELA RDVQARKQYL GV                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page