(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE259

ALDEN1_2.PE259       Location/Qualifiers
FT   CDS             292258..295158
FT                   /locus_tag="Alide_0263"
FT                   /gene_family="HOG000131249" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00112"
FT                   /codon_start="1"
FT                   /product="peptidase c1a papain"
FT                   /transl_table="11"
FT                   /note="KEGG: kpe:KPK_1160 peptidoglycan binding
FT                   domain/papain family cysteine protease; PFAM: peptidase C1A
FT                   papain; SMART: peptidase C1A papain"
FT                   /db_xref="GI:319760997"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="GeneID:10102286"
FT                   /translation="MPTYLLRQGSQDPLVARLRKVLVAELGDAAESYPQLDKGGATFDA
FT                   MLDAALRCWQNGRGLIADGIVGPCNLLALGLADWPPLDCELNTDSVHALFPATKPVNIA
FT                   RYLGYVTAALRAVGLLGRDMVLAALGTIRAETEGFVPISEFQSKYNTAPGGAPFALYDG
FT                   RLGNRRGEGAMFRGRGFVQLTGRSNYETYGAKLGLDLAATPELANAPEVAALLLALFLD
FT                   AHRDAMQACLAAGDLKGARRLVNGGSHGLANFQSVFELAQNALPAAAAPAAPPPVGRRA
FT                   GGRAGATATRKRAPRGQAAQEPASGRTLNAQADAPDLRDRPYTPPPASLQPEWPTTEAV
FT                   TQWLPAYAKAGLVLNQGQEGACTGFGLAGVVNYLRWVRAGLPKAMVSVSPRMLYNMARR
FT                   YDEYAGENYEGSSCRGAIKGWFNHGVCLEDDWPYQAAAQLPPHFGFAERARGTTVGVYY
FT                   RIDTSSISDLQAAIMHVGAIFVSSYVHAGWQEVATSTLPKGHASLPVIAFDGIPRRDAG
FT                   HAYALVGYNDRGFVLQNSWGPGWGAHGFAVLSYEDWLQHAMDAWVVALGVPGLIGGGRN
FT                   VPLAAGGRAAAGGGWSESQTLDHVISVGNDGRMSRYLTTDERTRNLSYQVSVLPDQWFR
FT                   AQPPEGKKRLILYVHGGLNSEADGIKRARSLGRLFEANGCYPLFVVWHTGLLESIRYYL
FT                   DDWRAGRPAAAGVKEWATERTDALIESTIGRTVVRALWSEMKENAGYAWQATRAGDLLV
FT                   RALGELRALWGDQLEVHLMGHSAGSIWLGHMLTWMAKAQATSGAPGLREAVAGVHLYAP
FT                   ACTVAFANQHFADKALLGRTHVAVLSDDRERDDNTAYIYRKSLLYLVSNALEQDRRTPL
FT                   LGLERALTGRNDQNTWDGASTTGETLAIWRRAAAEARLASRLKIVSEDKVLTATPDVRI
FT                   PASHGAFDNDVAIVGATLERICGQPLREPPRDLRGY"
FT                   /protein_id="YP_004124934.1"
     MPTYLLRQGS QDPLVARLRK VLVAELGDAA ESYPQLDKGG ATFDAMLDAA LRCWQNGRGL        60
     IADGIVGPCN LLALGLADWP PLDCELNTDS VHALFPATKP VNIARYLGYV TAALRAVGLL       120
     GRDMVLAALG TIRAETEGFV PISEFQSKYN TAPGGAPFAL YDGRLGNRRG EGAMFRGRGF       180
     VQLTGRSNYE TYGAKLGLDL AATPELANAP EVAALLLALF LDAHRDAMQA CLAAGDLKGA       240
     RRLVNGGSHG LANFQSVFEL AQNALPAAAA PAAPPPVGRR AGGRAGATAT RKRAPRGQAA       300
     QEPASGRTLN AQADAPDLRD RPYTPPPASL QPEWPTTEAV TQWLPAYAKA GLVLNQGQEG       360
     ACTGFGLAGV VNYLRWVRAG LPKAMVSVSP RMLYNMARRY DEYAGENYEG SSCRGAIKGW       420
     FNHGVCLEDD WPYQAAAQLP PHFGFAERAR GTTVGVYYRI DTSSISDLQA AIMHVGAIFV       480
     SSYVHAGWQE VATSTLPKGH ASLPVIAFDG IPRRDAGHAY ALVGYNDRGF VLQNSWGPGW       540
     GAHGFAVLSY EDWLQHAMDA WVVALGVPGL IGGGRNVPLA AGGRAAAGGG WSESQTLDHV       600
     ISVGNDGRMS RYLTTDERTR NLSYQVSVLP DQWFRAQPPE GKKRLILYVH GGLNSEADGI       660
     KRARSLGRLF EANGCYPLFV VWHTGLLESI RYYLDDWRAG RPAAAGVKEW ATERTDALIE       720
     STIGRTVVRA LWSEMKENAG YAWQATRAGD LLVRALGELR ALWGDQLEVH LMGHSAGSIW       780
     LGHMLTWMAK AQATSGAPGL REAVAGVHLY APACTVAFAN QHFADKALLG RTHVAVLSDD       840
     RERDDNTAYI YRKSLLYLVS NALEQDRRTP LLGLERALTG RNDQNTWDGA STTGETLAIW       900
     RRAAAEARLA SRLKIVSEDK VLTATPDVRI PASHGAFDND VAIVGATLER ICGQPLREPP       960
     RDLRGY                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page