(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE26

ALDEN1_2.PE26        Location/Qualifiers
FT   CDS             complement(33405..35498)
FT                   /locus_tag="Alide_0026"
FT                   /gene_family="HOG000220089" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02222"
FT                   /codon_start="1"
FT                   /product="ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp; CoA-binding domain protein; KEGG:
FT                   rme:Rmet_0842 CoA-binding"
FT                   /db_xref="GI:319760764"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="GeneID:10102049"
FT                   /translation="MTTHRLEPLLNPASIAIVGASSNPARIGGMPLAHLTRFGYAGRIY
FT                   PINPKYEEVFGLRCWRDIEALPAAPDLAVLAIAAQDVLPMLRRCAAKGVRAAIVYAAGF
FT                   AEAGAQGAALQAELEAFVAGTDMVVAGPNAMGFANLNSQAHTSFASVFNTAPMQQGPGS
FT                   VSLLTQSGNVCAAVYAIARRLGVDFSHFINTGNEACVDFAQYLEYLAQDAATQVCVGYM
FT                   EELRDGPRFIAAAEEFARRDKLLVLYKAGETDKGAQAVRSHTSALAGDQAIYRAAFRQL
FT                   DIIQSHDFVQMAQLAHLAGYRHRRAGRRVAIITISGALGAILADKFIGAGLDVPTLPQA
FT                   LQDQLRAGIPDYGMVSNPVDVTGNVVNDPGFVRTAMQALAQSDAVDTVLVYAPGYLLDR
FT                   MADDLCAVSRQYPKLFVAIDTGAATAREQLRAGGVPVFEDIGVATSALAPFLLWQERRR
FT                   RNRWMAVRRQSAPARAALPDSLDEYRTKRLLAQHGVPAAPERVAATADEAAAAADAIGY
FT                   PVVIKVLSPDIAHKTEAGGVRLRLADAAQVRQAFGEVLASCRRHDPRARIEGILVCRME
FT                   SGVAELIVGATRDPVFGMTLTVGLGGVLTELYQDVSHRVLPVDEAMAREMLGELKAFPL
FT                   LAGYRGRPPGDVDAACAAIAAFSRAVLALGDQVAEVEVNPLLVKEAGQGACMLDALAIP
FT                   SGQ"
FT                   /protein_id="YP_004124701.1"
     MTTHRLEPLL NPASIAIVGA SSNPARIGGM PLAHLTRFGY AGRIYPINPK YEEVFGLRCW        60
     RDIEALPAAP DLAVLAIAAQ DVLPMLRRCA AKGVRAAIVY AAGFAEAGAQ GAALQAELEA       120
     FVAGTDMVVA GPNAMGFANL NSQAHTSFAS VFNTAPMQQG PGSVSLLTQS GNVCAAVYAI       180
     ARRLGVDFSH FINTGNEACV DFAQYLEYLA QDAATQVCVG YMEELRDGPR FIAAAEEFAR       240
     RDKLLVLYKA GETDKGAQAV RSHTSALAGD QAIYRAAFRQ LDIIQSHDFV QMAQLAHLAG       300
     YRHRRAGRRV AIITISGALG AILADKFIGA GLDVPTLPQA LQDQLRAGIP DYGMVSNPVD       360
     VTGNVVNDPG FVRTAMQALA QSDAVDTVLV YAPGYLLDRM ADDLCAVSRQ YPKLFVAIDT       420
     GAATAREQLR AGGVPVFEDI GVATSALAPF LLWQERRRRN RWMAVRRQSA PARAALPDSL       480
     DEYRTKRLLA QHGVPAAPER VAATADEAAA AADAIGYPVV IKVLSPDIAH KTEAGGVRLR       540
     LADAAQVRQA FGEVLASCRR HDPRARIEGI LVCRMESGVA ELIVGATRDP VFGMTLTVGL       600
     GGVLTELYQD VSHRVLPVDE AMAREMLGEL KAFPLLAGYR GRPPGDVDAA CAAIAAFSRA       660
     VLALGDQVAE VEVNPLLVKE AGQGACMLDA LAIPSGQ                                697
//

If you have problems or comments...

PBIL Back to PBIL home page