(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE260

ALDEN1_2.PE260       Location/Qualifiers
FT   CDS             complement(297101..298636)
FT                   /locus_tag="Alide_0266"
FT                   /gene_family="HOG000246698" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /codon_start="1"
FT                   /product="mg chelatase, subunit chli"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: dia:Dtpsy_0179 Mg chelatase,
FT                   subunit ChlI; SMART: AAA ATPase"
FT                   /db_xref="GI:319760998"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="GeneID:10102289"
FT                   /translation="MSLALVQSRALLGLQASAVTVEVHLANGLPSFALVGLADVEVKEA
FT                   RERVRSALQNAGLEFPTNKKITVNLAPADLPKDSGRYDLPIALGILAASGQIAAERLAG
FT                   WEFAGELSLSGLLRPVRGALATSLALRAEQPPVRMVLPPGSAEEAALVPGAEIYRARHL
FT                   LDVVRQFLPAAAPPQEDDDGWQRLAPAAPAVHTSSPDLADVKGQAAAKRALEIAAAGGH
FT                   GLLLVGPPGSGKSMLAQRFASLLPPMSVEQALESAAIASLAGRFTGAQWMQRVTASPHH
FT                   SCSAVALVGGGSPPRPGEISLAHEGVLFLDEFPEFARSALEALREPLETGLITISRAAQ
FT                   RAEFPARFQLVAAMNPCPCGFAGSAQRACRCTPDQVARYQGKLSGPLLDRIDLHVEVPH
FT                   LPAEDLLNAPAGEASSAVRERVARAHALALARQGTPNQALQGQQLDRMAALDEAAARFL
FT                   QTAAARMGWSARGTHRALKVARTIADLAASEQVGMAHVAEAVQYRRVLRGTQA"
FT                   /protein_id="YP_004124935.1"
     MSLALVQSRA LLGLQASAVT VEVHLANGLP SFALVGLADV EVKEARERVR SALQNAGLEF        60
     PTNKKITVNL APADLPKDSG RYDLPIALGI LAASGQIAAE RLAGWEFAGE LSLSGLLRPV       120
     RGALATSLAL RAEQPPVRMV LPPGSAEEAA LVPGAEIYRA RHLLDVVRQF LPAAAPPQED       180
     DDGWQRLAPA APAVHTSSPD LADVKGQAAA KRALEIAAAG GHGLLLVGPP GSGKSMLAQR       240
     FASLLPPMSV EQALESAAIA SLAGRFTGAQ WMQRVTASPH HSCSAVALVG GGSPPRPGEI       300
     SLAHEGVLFL DEFPEFARSA LEALREPLET GLITISRAAQ RAEFPARFQL VAAMNPCPCG       360
     FAGSAQRACR CTPDQVARYQ GKLSGPLLDR IDLHVEVPHL PAEDLLNAPA GEASSAVRER       420
     VARAHALALA RQGTPNQALQ GQQLDRMAAL DEAAARFLQT AAARMGWSAR GTHRALKVAR       480
     TIADLAASEQ VGMAHVAEAV QYRRVLRGTQ A                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page