(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE261

ALDEN1_2.PE261       Location/Qualifiers
FT   CDS             298775..299506
FT                   /locus_tag="Alide_0267"
FT                   /gene_family="HOG000286927" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09694"
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein chp02001"
FT                   /transl_table="11"
FT                   /note="PFAM: Conserved hypothetical protein CHP02001; KEGG:
FT                   dia:Dtpsy_0180 hypothetical protein"
FT                   /db_xref="GI:319760999"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="GeneID:10102290"
FT                   /translation="MSHASLKSLSLALVAAAMPVLASAELTANVALTSNYKFRGQDQDV
FT                   HRIKAVSPAIQGGFDYTFGESGFYLGNWNSSVDWLQGNSIESDLYGGYRFKAGALDLDL
FT                   GALAYIYPGNTAGNTTELYGAATWGPLTAKYSHTVSKDYFGWAGAKTSGLRGRNTGYLN
FT                   LAFAREVAPSVTLKAAVGYTRFAGDIRDLGVPSYVDYSVGGAYDFGAGLSLSAAVAGAN
FT                   KKGFFGDANKARLIVTLSKTL"
FT                   /protein_id="YP_004124936.1"
     MSHASLKSLS LALVAAAMPV LASAELTANV ALTSNYKFRG QDQDVHRIKA VSPAIQGGFD        60
     YTFGESGFYL GNWNSSVDWL QGNSIESDLY GGYRFKAGAL DLDLGALAYI YPGNTAGNTT       120
     ELYGAATWGP LTAKYSHTVS KDYFGWAGAK TSGLRGRNTG YLNLAFAREV APSVTLKAAV       180
     GYTRFAGDIR DLGVPSYVDY SVGGAYDFGA GLSLSAAVAG ANKKGFFGDA NKARLIVTLS       240
     KTL                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page