(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE262

ALDEN1_2.PE262       Location/Qualifiers
FT   CDS             299526..299864
FT                   /locus_tag="Alide_0268"
FT                   /gene_family="HOG000017847" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /codon_start="1"
FT                   /product="nitrogen regulatory protein p-ii"
FT                   /transl_table="11"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   aav:Aave_0233 nitrogen regulatory protein P-II"
FT                   /db_xref="GI:319761000"
FT                   /db_xref="GO:0030234"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="GeneID:10102291"
FT                   /translation="MKMITAIIKPFKLDEVREALSDVGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVADDLAERVIEAIEGAARTGKIGDGKIFVADLEQVVRIRT
FT                   GETGGQAL"
FT                   /protein_id="YP_004124937.1"
     MKMITAIIKP FKLDEVREAL SDVGVQGITV TEVKGFGRQK GHTELYRGAE YVVDFLPKVK        60
     IEAAVADDLA ERVIEAIEGA ARTGKIGDGK IFVADLEQVV RIRTGETGGQ AL               112
//

If you have problems or comments...

PBIL Back to PBIL home page