(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE263

ALDEN1_2.PE263       Location/Qualifiers
FT   CDS             299887..301275
FT                   /locus_tag="Alide_0269"
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /codon_start="1"
FT                   /product="ammonium transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0164 ammonium transporter; TIGRFAM:
FT                   ammonium transporter; PFAM: ammonium transporter"
FT                   /db_xref="GI:319761001"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="GeneID:10102292"
FT                   /translation="MRKLLASLALGLHLLAGGTAALAQAPAAAPEPVAAAAAPAPDAAP
FT                   ATAPEAAPAPKVDSGDTAWMLTSTLLVILMTIPGLALFYGGLGRAKNMLSVLMQVFVVF
FT                   SLISILWSLYGYSLAFSGEGRLVGDLSKAFLQGVGPETFGALATIPEYVFLAFQGTFAA
FT                   ITVALVVGSFAERMRFSAVLIFALLWFTFSYVPMAHIVWGGGLLAQDGALDFAGGTVVH
FT                   INAGIAGLVGAYMVGKRIGFGREAFTPHSLTLTMVGASLLWVGWFGFNAGSAGAANAAA
FT                   GLAFVNTVLATAAATLSWIAGEAVHKGKASMLGAASGAVAGLVAVTPAAGFVGPMGAIA
FT                   IGLVAGLVCLWGVGGLKRMLRVDDAFDVFGVHGVGGIVGAILTGVFAAQGLGGTGGATP
FT                   ETFSMGAQVWIQTKSVLFTIVWSGVVSVVAYKIADLLVGLRVDEESERQGLDISAHGET
FT                   AYHR"
FT                   /protein_id="YP_004124938.1"
     MRKLLASLAL GLHLLAGGTA ALAQAPAAAP EPVAAAAAPA PDAAPATAPE AAPAPKVDSG        60
     DTAWMLTSTL LVILMTIPGL ALFYGGLGRA KNMLSVLMQV FVVFSLISIL WSLYGYSLAF       120
     SGEGRLVGDL SKAFLQGVGP ETFGALATIP EYVFLAFQGT FAAITVALVV GSFAERMRFS       180
     AVLIFALLWF TFSYVPMAHI VWGGGLLAQD GALDFAGGTV VHINAGIAGL VGAYMVGKRI       240
     GFGREAFTPH SLTLTMVGAS LLWVGWFGFN AGSAGAANAA AGLAFVNTVL ATAAATLSWI       300
     AGEAVHKGKA SMLGAASGAV AGLVAVTPAA GFVGPMGAIA IGLVAGLVCL WGVGGLKRML       360
     RVDDAFDVFG VHGVGGIVGA ILTGVFAAQG LGGTGGATPE TFSMGAQVWI QTKSVLFTIV       420
     WSGVVSVVAY KIADLLVGLR VDEESERQGL DISAHGETAY HR                          462
//

If you have problems or comments...

PBIL Back to PBIL home page