(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE265

ALDEN1_2.PE265       Location/Qualifiers
FT   CDS             complement(302321..303196)
FT                   /locus_tag="Alide_0271"
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.1.1.60"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.60"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_4431 6-phosphogluconate
FT                   dehydrogenase, NAD-binding; PFAM: 6-phosphogluconate
FT                   dehydrogenase NAD-binding"
FT                   /db_xref="GI:319761003"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="GeneID:10102294"
FT                   /translation="MSGPVLGFIGVGVMGEGMCRNLLAKSGLPVHVADVQAENVARLAA
FT                   QGAVASSVRALRETAHTVFLSLPSIDQVEEVCLGADPLVAPGGSVKTVVDMSTSDVPRT
FT                   RALAGRLAALGVRFLDAPVARSREAANNGTLLITVGGPADLFETVAPWLRCMGSDVVHC
FT                   GGVGAGQVVKIMNNMVLLSTVNSLAEAMAIAEAAGVDKALLAGVLRLGSADSFALKLTG
FT                   ERLATDVFPEKLFPTAYALKDLKLALGLAQASGIQPAVAQATAALLDAACARGYAMNYY
FT                   PVIYRLVEKQ"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /protein_id="YP_004124940.1"
     MSGPVLGFIG VGVMGEGMCR NLLAKSGLPV HVADVQAENV ARLAAQGAVA SSVRALRETA        60
     HTVFLSLPSI DQVEEVCLGA DPLVAPGGSV KTVVDMSTSD VPRTRALAGR LAALGVRFLD       120
     APVARSREAA NNGTLLITVG GPADLFETVA PWLRCMGSDV VHCGGVGAGQ VVKIMNNMVL       180
     LSTVNSLAEA MAIAEAAGVD KALLAGVLRL GSADSFALKL TGERLATDVF PEKLFPTAYA       240
     LKDLKLALGL AQASGIQPAV AQATAALLDA ACARGYAMNY YPVIYRLVEK Q                291
//

If you have problems or comments...

PBIL Back to PBIL home page