(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE267

ALDEN1_2.PE267       Location/Qualifiers
FT   CDS             complement(304623..305603)
FT                   /locus_tag="Alide_0273"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BB3069"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bbr:BB3069 hypothetical protein"
FT                   /db_xref="GI:319761005"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="GeneID:10102296"
FT                   /translation="MTSLSKRALVLGAAALTLGGHAFAQGAADWPAAKPVTIVVGFSAG
FT                   GPTDVVARIVAEQLSAKFKQSFVVDNKAGASGGVAANLVKQAAPDGYTLMFGSSSTLSI
FT                   IPTLQKTAYDPLRDFTAIALVASYPYFLVVPASSSIKSLDELLKQGRAGGSQLSYGSAG
FT                   NGAVNHLAGEWFKHEAKINAVHIPYKGDSAAVTDLVAGRLDFAFLAGSVALPQVKAGKM
FT                   RVLASASAVAGRGGEGVPTLGERYKGFAAEPWNGLMGPRGVPEPIVARLNAAVNEIMAR
FT                   PDVLARLAPMEQYAFTGTPRQFTDHIKSQTERWAAVIQSSNIQAD"
FT                   /protein_id="YP_004124942.1"
     MTSLSKRALV LGAAALTLGG HAFAQGAADW PAAKPVTIVV GFSAGGPTDV VARIVAEQLS        60
     AKFKQSFVVD NKAGASGGVA ANLVKQAAPD GYTLMFGSSS TLSIIPTLQK TAYDPLRDFT       120
     AIALVASYPY FLVVPASSSI KSLDELLKQG RAGGSQLSYG SAGNGAVNHL AGEWFKHEAK       180
     INAVHIPYKG DSAAVTDLVA GRLDFAFLAG SVALPQVKAG KMRVLASASA VAGRGGEGVP       240
     TLGERYKGFA AEPWNGLMGP RGVPEPIVAR LNAAVNEIMA RPDVLARLAP MEQYAFTGTP       300
     RQFTDHIKSQ TERWAAVIQS SNIQAD                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page