(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE268

ALDEN1_2.PE268       Location/Qualifiers
FT   CDS             complement(305633..306412)
FT                   /locus_tag="Alide_0274"
FT                   /gene_family="HOG000144809" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_3256"
FT                   /codon_start="1"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mrd:Mrad2831_3256 beta-lactamase
FT                   domain-containing protein"
FT                   /db_xref="GI:319761006"
FT                   /db_xref="GeneID:10102297"
FT                   /translation="MSEYQILAVKYATVDRARGSNFLHSAPGDPDAPMALDFFVWLIDG
FT                   PGGAVLVDTGFSPASAIARGRRYLVSPPESLRRLGHAPESIRDVVVTHLHYDHAGNVGE
FT                   FPAATAWVQDREMRYATGDCMCDPKQNHFFSTDDVAVLIRRLYQGSVRLVDGFHELRDG
FT                   IELHRVGGHTDGLQVARVRTARGWVVLASDAAHYYENLALQNPFPAIFSLPDMLAGYAR
FT                   IRALADGEDLIVPGHDPAVCTRFESAGVPGVHAYRIA"
FT                   /protein_id="YP_004124943.1"
     MSEYQILAVK YATVDRARGS NFLHSAPGDP DAPMALDFFV WLIDGPGGAV LVDTGFSPAS        60
     AIARGRRYLV SPPESLRRLG HAPESIRDVV VTHLHYDHAG NVGEFPAATA WVQDREMRYA       120
     TGDCMCDPKQ NHFFSTDDVA VLIRRLYQGS VRLVDGFHEL RDGIELHRVG GHTDGLQVAR       180
     VRTARGWVVL ASDAAHYYEN LALQNPFPAI FSLPDMLAGY ARIRALADGE DLIVPGHDPA       240
     VCTRFESAGV PGVHAYRIA                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page