(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE269

ALDEN1_2.PE269       Location/Qualifiers
FT   CDS             complement(306409..307635)
FT                   /locus_tag="Alide_0275"
FT                   /gene_family="HOG000253828" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Reut_B3887"
FT                   /codon_start="1"
FT                   /product="urea/short-chain amide abc transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B3887 UreA/short-chain amide ABC
FT                   transporter"
FT                   /db_xref="GI:319761007"
FT                   /db_xref="GeneID:10102298"
FT                   /translation="MTFTPTKAALGAALLAASMLAPAQDKGARISDGIVKIGVLTDING
FT                   PFMDNVGKGSIVATEIAIEEFKGKVLGYPIQMVTADHQNKADVASTRVREWFDRDQVDA
FT                   VTELGNSAVALAAMRLAQDKNRISIVTGAGAVRISNEDCTPNNLHWVYDTYSLAKVGTQ
FT                   SVVKGGAKTWYYLTADYAFGHSLENDGRHFIEAAGGKVLGSSRYPFPGNDFASYIIKAQ
FT                   GSKANAVAIATAGLDLQNAIKQGKEFGLASGGQKTVAMLMSIMDVHGVGLKDAGGMLFA
FT                   ESFYWDLDDASRAFSRKFFERTKRMPTALQAGQYSATLNYLKAIQKARSDDVADVMKAI
FT                   KSMPIEDAFAKNGKVRADGKMVHDMYLVRVKTPKESQAAWDYYTVLETVPGAQAFHSAA
FT                   ESKCPLLKP"
FT                   /protein_id="YP_004124944.1"
     MTFTPTKAAL GAALLAASML APAQDKGARI SDGIVKIGVL TDINGPFMDN VGKGSIVATE        60
     IAIEEFKGKV LGYPIQMVTA DHQNKADVAS TRVREWFDRD QVDAVTELGN SAVALAAMRL       120
     AQDKNRISIV TGAGAVRISN EDCTPNNLHW VYDTYSLAKV GTQSVVKGGA KTWYYLTADY       180
     AFGHSLENDG RHFIEAAGGK VLGSSRYPFP GNDFASYIIK AQGSKANAVA IATAGLDLQN       240
     AIKQGKEFGL ASGGQKTVAM LMSIMDVHGV GLKDAGGMLF AESFYWDLDD ASRAFSRKFF       300
     ERTKRMPTAL QAGQYSATLN YLKAIQKARS DDVADVMKAI KSMPIEDAFA KNGKVRADGK       360
     MVHDMYLVRV KTPKESQAAW DYYTVLETVP GAQAFHSAAE SKCPLLKP                    408
//

If you have problems or comments...

PBIL Back to PBIL home page