(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE27

ALDEN1_2.PE27        Location/Qualifiers
FT   CDS             complement(35513..36313)
FT                   /locus_tag="Alide_0027"
FT                   /gene_family="HOG000027943" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rme:Rmet_0841 enoyl-CoA hydratase"
FT                   /db_xref="GI:319760765"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:10102050"
FT                   /translation="MAFDTLEIENHGAVRRILLAREAQRNAQSQQMLDELMTALDDARH
FT                   DDGVHAVVIGGKGAHFSAGHDLKQAQAERSSFTVEERWAYEELRYFDYSLRIWDFPKPT
FT                   IAQVQGACVAGGFMIANMCDLVVAGESAYFSDPVGHTLGAAATEVLIHPWVMGARKAKE
FT                   LLFTGGRLSASEAHAIGMVNRVVSDAGLGESTLALAQQIAKAPPFGLRLIKRSINRTLD
FT                   AQGLRTALAAHFDTHQLSHLSEGFLTARDRGLANAIQKNREASA"
FT                   /protein_id="YP_004124702.1"
     MAFDTLEIEN HGAVRRILLA REAQRNAQSQ QMLDELMTAL DDARHDDGVH AVVIGGKGAH        60
     FSAGHDLKQA QAERSSFTVE ERWAYEELRY FDYSLRIWDF PKPTIAQVQG ACVAGGFMIA       120
     NMCDLVVAGE SAYFSDPVGH TLGAAATEVL IHPWVMGARK AKELLFTGGR LSASEAHAIG       180
     MVNRVVSDAG LGESTLALAQ QIAKAPPFGL RLIKRSINRT LDAQGLRTAL AAHFDTHQLS       240
     HLSEGFLTAR DRGLANAIQK NREASA                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page