(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE270

ALDEN1_2.PE270       Location/Qualifiers
FT   CDS             complement(307797..308687)
FT                   /locus_tag="Alide_0276"
FT                   /gene_family="HOG000219610" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.1.1.31"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.31"
FT                   /transl_table="11"
FT                   /note="KEGG: esa:ESA_04058 hypothetical protein; PFAM:
FT                   6-phosphogluconate dehydrogenase NAD-binding"
FT                   /db_xref="GI:319761008"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="GeneID:10102299"
FT                   /translation="MKAGFIGLGRMGFALASHLLRNGVQLAVHDIQSAPVDKLVALGAS
FT                   RAASVQALAAGADVVFTMLPGPKQSREVILGEGGVLAGLRRGGCLVELSTIDTDTVDAL
FT                   AAAAEKQGVRFADAPVGRLAAHADRGESLFMLGAHDADRVALEPLLLKMGTTVLHCGAP
FT                   GSGTRMKLINNLMVLCYCQLNSEVLVLAGALGLDARKTFDVLTGTTASNGQLKEKWPVK
FT                   VLAGDLTPGFDIALGFKDLTLACQAAQSAGVSLPMGNLARSLFQLARHAGKDGQDTSCM
FT                   TDFWAESNGQPPVRL"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /protein_id="YP_004124945.1"
     MKAGFIGLGR MGFALASHLL RNGVQLAVHD IQSAPVDKLV ALGASRAASV QALAAGADVV        60
     FTMLPGPKQS REVILGEGGV LAGLRRGGCL VELSTIDTDT VDALAAAAEK QGVRFADAPV       120
     GRLAAHADRG ESLFMLGAHD ADRVALEPLL LKMGTTVLHC GAPGSGTRMK LINNLMVLCY       180
     CQLNSEVLVL AGALGLDARK TFDVLTGTTA SNGQLKEKWP VKVLAGDLTP GFDIALGFKD       240
     LTLACQAAQS AGVSLPMGNL ARSLFQLARH AGKDGQDTSC MTDFWAESNG QPPVRL           296
//

If you have problems or comments...

PBIL Back to PBIL home page