(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE271

ALDEN1_2.PE271       Location/Qualifiers
FT   CDS             complement(308684..309544)
FT                   /locus_tag="Alide_0277"
FT                   /gene_family="HOG000076805" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   msm:MSMEG_2534 carboxylesterase protein"
FT                   /db_xref="GI:319761009"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="GeneID:10102300"
FT                   /translation="MRVEKEAATGGYVNFDIAGRMCRVYYETAGSGQPLLCLHTAGSDT
FT                   RQYRALLNSPELTANHQVICFDMPWHGKSSPPEGWHTEEYRLTSALYVQTILAFMDAMQ
FT                   VERPIAMGCSIGGRVVLHLALQCPERFKALIGLQSGAHVNPYYDLDWLHRPDVHGGEVC
FT                   AGIVSGLVGPGAPERDRWETLWHYMQGGPGVFKGDLHFYTGEGDLRGRVQRIDTARCPL
FT                   YLLTGEYDYSCTPEDSEDLARLIPGAQLQIMPGLGHFPMSEAPQEFLRHLLPVLQRIHT
FT                   NEGNT"
FT                   /protein_id="YP_004124946.1"
     MRVEKEAATG GYVNFDIAGR MCRVYYETAG SGQPLLCLHT AGSDTRQYRA LLNSPELTAN        60
     HQVICFDMPW HGKSSPPEGW HTEEYRLTSA LYVQTILAFM DAMQVERPIA MGCSIGGRVV       120
     LHLALQCPER FKALIGLQSG AHVNPYYDLD WLHRPDVHGG EVCAGIVSGL VGPGAPERDR       180
     WETLWHYMQG GPGVFKGDLH FYTGEGDLRG RVQRIDTARC PLYLLTGEYD YSCTPEDSED       240
     LARLIPGAQL QIMPGLGHFP MSEAPQEFLR HLLPVLQRIH TNEGNT                      286
//

If you have problems or comments...

PBIL Back to PBIL home page