(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE273

ALDEN1_2.PE273       Location/Qualifiers
FT   CDS             complement(309967..311034)
FT                   /locus_tag="Alide_0279"
FT                   /gene_family="HOG000247836" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03082"
FT                   /codon_start="1"
FT                   /product="membrane protein abrb duplication"
FT                   /transl_table="11"
FT                   /note="KEGG: vap:Vapar_4786 membrane protein AbrB
FT                   duplication; TIGRFAM: membrane protein AbrB duplication;
FT                   PFAM: ammonia monooxygenase"
FT                   /db_xref="GI:319761011"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="GeneID:10102302"
FT                   /translation="MRSTLSKLLTLLLAWAAAEGCRRLRMPVPWMLGPLLATALATMAG
FT                   QPTRSSLRLRNCGQWVMGASLGLYFTPPVVAQLIGLWWAVLAAVAWALALGAAYGRWLY
FT                   RSCAGRLRGVSDAALRPSAYFAGAIGAASEMTLLAEREGARTDLVAASHSLRMLIVVLV
FT                   MPFGMLLAKAWWNLETVDLVPPASAPFAAAGLAWLALFTGAGGLALQLGRLPNPWFLGP
FT                   LLVAIGLSATGTAPSGVPTPLSNAAQLVIGVSLGVRFSPLFLHTAPRWLAQVALGTLGL
FT                   LAACAAFGLLLAWATGLHAATAILGTAPGGMTEMSITAKVLQLGVPVVTALQVTRLVAV
FT                   LVLVRPAYRLWARQP"
FT                   /protein_id="YP_004124948.1"
     MRSTLSKLLT LLLAWAAAEG CRRLRMPVPW MLGPLLATAL ATMAGQPTRS SLRLRNCGQW        60
     VMGASLGLYF TPPVVAQLIG LWWAVLAAVA WALALGAAYG RWLYRSCAGR LRGVSDAALR       120
     PSAYFAGAIG AASEMTLLAE REGARTDLVA ASHSLRMLIV VLVMPFGMLL AKAWWNLETV       180
     DLVPPASAPF AAAGLAWLAL FTGAGGLALQ LGRLPNPWFL GPLLVAIGLS ATGTAPSGVP       240
     TPLSNAAQLV IGVSLGVRFS PLFLHTAPRW LAQVALGTLG LLAACAAFGL LLAWATGLHA       300
     ATAILGTAPG GMTEMSITAK VLQLGVPVVT ALQVTRLVAV LVLVRPAYRL WARQP            355
//

If you have problems or comments...

PBIL Back to PBIL home page