(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE275

ALDEN1_2.PE275       Location/Qualifiers
FT   CDS             312538..313692
FT                   /locus_tag="Alide_0281"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: rme:Rmet_5425 butyryl-CoA dehydrogenase"
FT                   /db_xref="GI:319761013"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102304"
FT                   /translation="MDFTLSEEHQAFADSVARFAQDKLKDGALARAHSPHYPWETAALL
FT                   AEQGLLGIAFPEEDHGQGGTLMHAVLAIEQVALVCPKSADIVQAGNFGPIRTFVEYATP
FT                   EQKQRFLPDLLAGRKLISLGMSEPDAGSAVTELKTSARQEGDGYVINGSKVFSTHSPEA
FT                   DLFLVYVRFGPGVGGIGSVLVERGTPGFQVGEPSSFMNGERWSQLYFDECRIPAANVLL
FT                   GPGGFKKQISGFNVERLGNSARALALGRHAFNTAREHALTRKQFGRELCEFQGIQWKFA
FT                   EMAMKLEQAQLMLYRAAMEGEHGLPSAQSTAMAKLACNLAGWEVSNEALQVMGGTGFSQ
FT                   ECLVEYCVRRTRGWMIAGGSIEILKNRIAEGVFGRTFPQRPGKG"
FT                   /protein_id="YP_004124950.1"
     MDFTLSEEHQ AFADSVARFA QDKLKDGALA RAHSPHYPWE TAALLAEQGL LGIAFPEEDH        60
     GQGGTLMHAV LAIEQVALVC PKSADIVQAG NFGPIRTFVE YATPEQKQRF LPDLLAGRKL       120
     ISLGMSEPDA GSAVTELKTS ARQEGDGYVI NGSKVFSTHS PEADLFLVYV RFGPGVGGIG       180
     SVLVERGTPG FQVGEPSSFM NGERWSQLYF DECRIPAANV LLGPGGFKKQ ISGFNVERLG       240
     NSARALALGR HAFNTAREHA LTRKQFGREL CEFQGIQWKF AEMAMKLEQA QLMLYRAAME       300
     GEHGLPSAQS TAMAKLACNL AGWEVSNEAL QVMGGTGFSQ ECLVEYCVRR TRGWMIAGGS       360
     IEILKNRIAE GVFGRTFPQR PGKG                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page