(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE276

ALDEN1_2.PE276       Location/Qualifiers
FT   CDS             313716..314690
FT                   /locus_tag="Alide_0282"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Veis_3320"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_3320 hypothetical protein"
FT                   /db_xref="GI:319761014"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102305"
FT                   /translation="MKRSLLSLAALAACAWSIAVPAAADAAYPAKPVRIIVGYSAGGPT
FT                   DAVARLVAAHLQTKLGQPFVVDNRAGAGSNIASEAVAAAAPDGYTLLVAAAPLTMNSHV
FT                   YKNLKFDAVKSFVPISKLSSAPGVLAVRTDWGVGSVKEFVAAAKKEPGKFTYGTTGLGG
FT                   SQHMATELFQRLAGVKLTHIPYKGASNVMTDLIAGHVDLAFMTATGAMPHLQAGKVKPL
FT                   AVAGPQRLSGLPNVPTFAEAGYPAMISDSWNGLLAPAGTPEAIVKKLHAAAAEALQMPE
FT                   TRTKLESQGAIVIGNSPEEFRADIQREVAHWAEQFKAIKIEMQ"
FT                   /protein_id="YP_004124951.1"
     MKRSLLSLAA LAACAWSIAV PAAADAAYPA KPVRIIVGYS AGGPTDAVAR LVAAHLQTKL        60
     GQPFVVDNRA GAGSNIASEA VAAAAPDGYT LLVAAAPLTM NSHVYKNLKF DAVKSFVPIS       120
     KLSSAPGVLA VRTDWGVGSV KEFVAAAKKE PGKFTYGTTG LGGSQHMATE LFQRLAGVKL       180
     THIPYKGASN VMTDLIAGHV DLAFMTATGA MPHLQAGKVK PLAVAGPQRL SGLPNVPTFA       240
     EAGYPAMISD SWNGLLAPAG TPEAIVKKLH AAAAEALQMP ETRTKLESQG AIVIGNSPEE       300
     FRADIQREVA HWAEQFKAIK IEMQ                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page