(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE277

ALDEN1_2.PE277       Location/Qualifiers
FT   CDS             314687..316762
FT                   /locus_tag="Alide_0283"
FT                   /gene_family="HOG000220089" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /codon_start="1"
FT                   /product="CoA-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   dac:Daci_1885 CoA-binding domain-containing protein"
FT                   /db_xref="GI:319761015"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="GeneID:10102306"
FT                   /translation="MTPDNDKRLAQALLHPASVALYGASDDVDKMGGRPVQFLKRTGFA
FT                   GRIYPINPRRDEIQGLKAWPSLQSLPEVPDQVFVLTPTETVIPAVRECAALGVKVVTIL
FT                   ASGFSESGAEGAAREGELRRIAKETGIRILGPSSLGVVNPRTGLVLTANAAFAEPDLPP
FT                   GKVFVASHSGSMIGALVSRGKARGVGFAGLVSVGSEVDLNVGEICAATLDDPAIEGYLL
FT                   FLESLRHGPELRAFARAAHARGKPVIAYKLGRSAAAAEMATTHTGAIAGEDDIADAFLK
FT                   DMGVARVGVLEALLETFPLARRIPLESAPKRVGVVTTTGGGAAMAVEQLGIRGVVVEPP
FT                   SADALKRLEQAGLPCTPGRVLDMTLAGTKYETMKATLDILLTAPEFDLVLAVVGSSARF
FT                   QPQLAVKPIVECAGGPKPLAAMLVPDAPEALAALTAAGVPCFRAPEACGDAIAAVLARR
FT                   RPGPEPVLPAPGPARTLSEAEAYGVLHELGVPHAPVALRCFGEAPAPLPFAYPVVAKVC
FT                   SAEIPHKTEVGGVLLNIGSDEELAAALATLRRNLDERAPKAACDEVLVQPMQKGLSEVL
FT                   VGYRVDPDAGPIVMLAAGGIWAEVAKDRSIRLAPVTVETAREMVAEVNALKPLTGLRGK
FT                   ARGDLEALARTVSALSQLALKPELGIAEAEVNPLLVLPEGQGVVAVDALVFQRTPA"
FT                   /protein_id="YP_004124952.1"
     MTPDNDKRLA QALLHPASVA LYGASDDVDK MGGRPVQFLK RTGFAGRIYP INPRRDEIQG        60
     LKAWPSLQSL PEVPDQVFVL TPTETVIPAV RECAALGVKV VTILASGFSE SGAEGAAREG       120
     ELRRIAKETG IRILGPSSLG VVNPRTGLVL TANAAFAEPD LPPGKVFVAS HSGSMIGALV       180
     SRGKARGVGF AGLVSVGSEV DLNVGEICAA TLDDPAIEGY LLFLESLRHG PELRAFARAA       240
     HARGKPVIAY KLGRSAAAAE MATTHTGAIA GEDDIADAFL KDMGVARVGV LEALLETFPL       300
     ARRIPLESAP KRVGVVTTTG GGAAMAVEQL GIRGVVVEPP SADALKRLEQ AGLPCTPGRV       360
     LDMTLAGTKY ETMKATLDIL LTAPEFDLVL AVVGSSARFQ PQLAVKPIVE CAGGPKPLAA       420
     MLVPDAPEAL AALTAAGVPC FRAPEACGDA IAAVLARRRP GPEPVLPAPG PARTLSEAEA       480
     YGVLHELGVP HAPVALRCFG EAPAPLPFAY PVVAKVCSAE IPHKTEVGGV LLNIGSDEEL       540
     AAALATLRRN LDERAPKAAC DEVLVQPMQK GLSEVLVGYR VDPDAGPIVM LAAGGIWAEV       600
     AKDRSIRLAP VTVETAREMV AEVNALKPLT GLRGKARGDL EALARTVSAL SQLALKPELG       660
     IAEAEVNPLL VLPEGQGVVA VDALVFQRTP A                                      691
//

If you have problems or comments...

PBIL Back to PBIL home page