(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE28

ALDEN1_2.PE28        Location/Qualifiers
FT   CDS             36408..37172
FT                   /locus_tag="Alide_0028"
FT                   /gene_family="HOG000142058" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: bpt:Bpet3285 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760766"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102051"
FT                   /translation="MDTPQGTAGAQSLRRALQLLRLLAQHQEDGIRLTEVMAASGLERS
FT                   TAHRLLSCLVEEQFAERDPGSKAYRLGLDAMQLGFASMRRVPLVDHCRPLMQRLARMSG
FT                   DTVFLVIRQGDYCLCLHREEGHFPVKVFTTDVGGRRLLGLGAGGLALMAQLSDAEVERI
FT                   FDRHVEEYTQACFTRERLQQAVRRTRAAGYADIVDTLTVGVSGVGATFAASPGTLAAIS
FT                   FGAITPRLPPERKREMARLLMDQLVSNQAGGA"
FT                   /protein_id="YP_004124703.1"
     MDTPQGTAGA QSLRRALQLL RLLAQHQEDG IRLTEVMAAS GLERSTAHRL LSCLVEEQFA        60
     ERDPGSKAYR LGLDAMQLGF ASMRRVPLVD HCRPLMQRLA RMSGDTVFLV IRQGDYCLCL       120
     HREEGHFPVK VFTTDVGGRR LLGLGAGGLA LMAQLSDAEV ERIFDRHVEE YTQACFTRER       180
     LQQAVRRTRA AGYADIVDTL TVGVSGVGAT FAASPGTLAA ISFGAITPRL PPERKREMAR       240
     LLMDQLVSNQ AGGA                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page