(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE284

ALDEN1_2.PE284       Location/Qualifiers
FT   CDS             323210..324304
FT                   /locus_tag="Alide_0290"
FT                   /gene_family="HOG000031446" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /codon_start="1"
FT                   /EC_number="5.1.1.1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: alanine racemase; KEGG: ajs:Ajs_0176
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="GI:319761022"
FT                   /db_xref="GO:0008784"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="GeneID:10102313"
FT                   /translation="MPRPILATIHPAAVQHNLERARRAAPDARMWAVVKANAYGHGIER
FT                   VFEGLRSADGIALLDMAEAERVRRLGWRGPVLLLEGVFEPRDLELCSRLSLWHAVHCDE
FT                   QIDWLAAHKTQAPHRVFLKMNSGMNRLGFAPGRYRSAWARLNALPQVDEISFMTHFSDA
FT                   DGPRGIAHQVQAFHRATQDLPGERCIANSAAILRHGGEAQVRLDWVRAGIALYGSAPDH
FT                   PERTAVDWGLEPAMTLASRIIGVQQLQAGDTVGYGSRFTAEGPLAIGVVACGYADGYPR
FT                   HCDTGTPVLVNGVRTRTIGRVSMDMIAVDLTPVPGAGMGAEVTLWGRAANGVVLPIDEV
FT                   AEAGGTVGYELMCALAPRVPVSVD"
FT                   /product="alanine racemase"
FT                   /protein_id="YP_004124959.1"
     MPRPILATIH PAAVQHNLER ARRAAPDARM WAVVKANAYG HGIERVFEGL RSADGIALLD        60
     MAEAERVRRL GWRGPVLLLE GVFEPRDLEL CSRLSLWHAV HCDEQIDWLA AHKTQAPHRV       120
     FLKMNSGMNR LGFAPGRYRS AWARLNALPQ VDEISFMTHF SDADGPRGIA HQVQAFHRAT       180
     QDLPGERCIA NSAAILRHGG EAQVRLDWVR AGIALYGSAP DHPERTAVDW GLEPAMTLAS       240
     RIIGVQQLQA GDTVGYGSRF TAEGPLAIGV VACGYADGYP RHCDTGTPVL VNGVRTRTIG       300
     RVSMDMIAVD LTPVPGAGMG AEVTLWGRAA NGVVLPIDEV AEAGGTVGYE LMCALAPRVP       360
     VSVD                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page