(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE286

ALDEN1_2.PE286       Location/Qualifiers
FT   CDS             complement(325622..326236)
FT                   /locus_tag="Alide_0292"
FT                   /gene_family="HOG000125748" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /codon_start="1"
FT                   /product="glutathione s-transferase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   dia:Dtpsy_0197 glutathione S-transferase domain protein"
FT                   /db_xref="GI:319761024"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="GeneID:10102315"
FT                   /translation="MTTLTLYYAPGTCAQAVRIALEEAQAPYTPVRMDFASQQQRSPEY
FT                   LAINPKGRVPALVTEHGVLTETPALLAYVAQRFVQAGLAPADAFGFARMQEFNSYLAST
FT                   VHVAHAHRPRASRWADEPEAQAAMQRKVPANMTECFDVIERHYLGDGPWMLGEQYTVAD
FT                   GYLFTVAGWLKSDGVDIARFPKVHAHSQRMAARPAVQRALG"
FT                   /protein_id="YP_004124961.1"
     MTTLTLYYAP GTCAQAVRIA LEEAQAPYTP VRMDFASQQQ RSPEYLAINP KGRVPALVTE        60
     HGVLTETPAL LAYVAQRFVQ AGLAPADAFG FARMQEFNSY LASTVHVAHA HRPRASRWAD       120
     EPEAQAAMQR KVPANMTECF DVIERHYLGD GPWMLGEQYT VADGYLFTVA GWLKSDGVDI       180
     ARFPKVHAHS QRMAARPAVQ RALG                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page