(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE287

ALDEN1_2.PE287       Location/Qualifiers
FT   CDS             326367..327749
FT                   /locus_tag="Alide_0293"
FT                   /gene_family="HOG000218329" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /codon_start="1"
FT                   /product="DNA repair protein rada"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0199 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="GI:319761025"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="GeneID:10102316"
FT                   /translation="MAKDKTLYSCSECGASSPRWLGKCPGCGAWNTLIETVPDAGPGKN
FT                   RLSGAGQYAGLAQAQSVMPLAAIEATEVARTPSGIEELDRVLGGGVVEGGVVLIGGDPG
FT                   IGKSTLLLQAMDALQRVGLPTLYVTGEESGAQVALRSRRLGLEASQVNVLAEIQLEKIL
FT                   ATIEATQPAVAVIDSIQTIYSDQLTSAPGSVAQVRECAAHLTRLAKATGIAVVLVGHVT
FT                   KEGALAGPRVLEHMVDTVLYFEGDTHSSFRLVRAIKNRFGAVNEIGVFAMTERGLKGVA
FT                   NPSAIFLSQHSEPVPGSCVLVTLEGTRPLLVEIQALVDGGGPSPRRLSVGLERDRLAML
FT                   LAVLHRHAGVACADQDVFVNAVGGVRISEPAADLAVMLSITSSLRGRALPKGFIAFGEV
FT                   GLAGEVRPAPRGQERLKEAAKLGFTVAVVPKANAPKKPIPGLEIHAVERVDEAMAAVRG
FT                   LG"
FT                   /protein_id="YP_004124962.1"
     MAKDKTLYSC SECGASSPRW LGKCPGCGAW NTLIETVPDA GPGKNRLSGA GQYAGLAQAQ        60
     SVMPLAAIEA TEVARTPSGI EELDRVLGGG VVEGGVVLIG GDPGIGKSTL LLQAMDALQR       120
     VGLPTLYVTG EESGAQVALR SRRLGLEASQ VNVLAEIQLE KILATIEATQ PAVAVIDSIQ       180
     TIYSDQLTSA PGSVAQVREC AAHLTRLAKA TGIAVVLVGH VTKEGALAGP RVLEHMVDTV       240
     LYFEGDTHSS FRLVRAIKNR FGAVNEIGVF AMTERGLKGV ANPSAIFLSQ HSEPVPGSCV       300
     LVTLEGTRPL LVEIQALVDG GGPSPRRLSV GLERDRLAML LAVLHRHAGV ACADQDVFVN       360
     AVGGVRISEP AADLAVMLSI TSSLRGRALP KGFIAFGEVG LAGEVRPAPR GQERLKEAAK       420
     LGFTVAVVPK ANAPKKPIPG LEIHAVERVD EAMAAVRGLG                             460
//

If you have problems or comments...

PBIL Back to PBIL home page