(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE288

ALDEN1_2.PE288       Location/Qualifiers
FT   CDS             complement(327753..328739)
FT                   /locus_tag="Alide_0294"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rmet_1769"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rme:Rmet_1769 hypothetical protein"
FT                   /db_xref="GI:319761026"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102317"
FT                   /translation="MTTSSRRHAVLAGALAALALACGPAAQAQEGDFTRIVVGFAPGGA
FT                   ADSLARIYAEQLRQDGLGNVLVENKPGASSRLALDYVKKAPADGKTVFIGPSPMFTIFP
FT                   LTYKKLSYDPDKDLVPVALLTDVPTVIATAVNAPYKTMDQYVQWLKQHPAQGSLGLASI
FT                   GSAGHLGAFALSKELGLSVTPTPYRGATPMLVDVVSGNVSMGWDAVASMMPLYRGNKLH
FT                   FLGVSGTRRIKALPEVPTAFEQGYKQFEYATSWYGAYVSGATPEPVKARLQEAFIKASR
FT                   NPATAARLEDLGLEVVGKSGAEARERMLKERAAWSPIVKASGFEAQD"
FT                   /protein_id="YP_004124963.1"
     MTTSSRRHAV LAGALAALAL ACGPAAQAQE GDFTRIVVGF APGGAADSLA RIYAEQLRQD        60
     GLGNVLVENK PGASSRLALD YVKKAPADGK TVFIGPSPMF TIFPLTYKKL SYDPDKDLVP       120
     VALLTDVPTV IATAVNAPYK TMDQYVQWLK QHPAQGSLGL ASIGSAGHLG AFALSKELGL       180
     SVTPTPYRGA TPMLVDVVSG NVSMGWDAVA SMMPLYRGNK LHFLGVSGTR RIKALPEVPT       240
     AFEQGYKQFE YATSWYGAYV SGATPEPVKA RLQEAFIKAS RNPATAARLE DLGLEVVGKS       300
     GAEARERMLK ERAAWSPIVK ASGFEAQD                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page