(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE291

ALDEN1_2.PE291       Location/Qualifiers
FT   CDS             330815..331753
FT                   /locus_tag="Alide_0297"
FT                   /gene_family="HOG000276706" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /codon_start="1"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0182 branched-chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase class IV"
FT                   /db_xref="GI:319761029"
FT                   /db_xref="GO:0004084"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="GeneID:10102320"
FT                   /translation="MSPVVPSMADRDGKIWMDGQMVDWRDAKIHVLTHSLHYGCGAFEG
FT                   VRAYKTEQGTAIFRLQEHTDRLFNSAKILRMKLPFTKEEVNEAQRAVVRANKLESCYLR
FT                   PLTWIGSEKLGVSPKGNKIHMIVAAWAWGAYLGEEGMARGIRVKTSSFTRHHVNITMTQ
FT                   AKASSNYTNSILANMEATDDGYDEALLLDSAGFVSEGSGENVFIIKDGVVYTPDLSAGA
FT                   LNGITRNTVLHICKDLGLELVQKRITRDEVYIADEAFFSGTAAEITPIRELDRVQIGGG
FT                   SRGPLTEKIQTAFFDIVNGRNPKYAHWLTKV"
FT                   /protein_id="YP_004124966.1"
     MSPVVPSMAD RDGKIWMDGQ MVDWRDAKIH VLTHSLHYGC GAFEGVRAYK TEQGTAIFRL        60
     QEHTDRLFNS AKILRMKLPF TKEEVNEAQR AVVRANKLES CYLRPLTWIG SEKLGVSPKG       120
     NKIHMIVAAW AWGAYLGEEG MARGIRVKTS SFTRHHVNIT MTQAKASSNY TNSILANMEA       180
     TDDGYDEALL LDSAGFVSEG SGENVFIIKD GVVYTPDLSA GALNGITRNT VLHICKDLGL       240
     ELVQKRITRD EVYIADEAFF SGTAAEITPI RELDRVQIGG GSRGPLTEKI QTAFFDIVNG       300
     RNPKYAHWLT KV                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page