(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE294

ALDEN1_2.PE294       Location/Qualifiers
FT   CDS             333387..334502
FT                   /locus_tag="Alide_0300"
FT                   /gene_family="HOG000224919" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ajs:Ajs_0185 glycosyl transferase, group 1"
FT                   /db_xref="GI:319761032"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:10102323"
FT                   /translation="MPEIARRPRVLHFVTGGFSGATQVAVDLVRAHALSGRCEALLVLR
FT                   RKRHTRGERVQALRDEGLAVETVAGWAHAATVWQLAAVCRRWRPDVLVAHGFSEHLWGR
FT                   YAGLVAGVPRLVQVEHNSRERYTAWRLRQALWLAGRTEAIVGVSEGVRQSLLARGFPPG
FT                   KTVAIPNGIPLAPYDCADGHDWAGRVPGIVMAARFARQKDHATLLRAVALLRQQGLTPP
FT                   VKLAGGGKAGARRAARRLCTELGLDGQVEFLGHCKDMPGLLMGHRICVLSTHYEGMPLS
FT                   LIEGMAAGCAVVGSRVVGVQEVIEDGRNGLLAGHADPRSLADALERLLTRDDEARRMAR
FT                   AARDDALRLYGLQTMTARYEDLLLRGLEHPR"
FT                   /protein_id="YP_004124969.1"
     MPEIARRPRV LHFVTGGFSG ATQVAVDLVR AHALSGRCEA LLVLRRKRHT RGERVQALRD        60
     EGLAVETVAG WAHAATVWQL AAVCRRWRPD VLVAHGFSEH LWGRYAGLVA GVPRLVQVEH       120
     NSRERYTAWR LRQALWLAGR TEAIVGVSEG VRQSLLARGF PPGKTVAIPN GIPLAPYDCA       180
     DGHDWAGRVP GIVMAARFAR QKDHATLLRA VALLRQQGLT PPVKLAGGGK AGARRAARRL       240
     CTELGLDGQV EFLGHCKDMP GLLMGHRICV LSTHYEGMPL SLIEGMAAGC AVVGSRVVGV       300
     QEVIEDGRNG LLAGHADPRS LADALERLLT RDDEARRMAR AARDDALRLY GLQTMTARYE       360
     DLLLRGLEHP R                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page