(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE296

ALDEN1_2.PE296       Location/Qualifiers
FT   CDS             335542..336516
FT                   /locus_tag="Alide_0302"
FT                   /gene_family="HOG000224917" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0187"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0187 hypothetical protein"
FT                   /db_xref="GI:319761034"
FT                   /db_xref="GeneID:10102325"
FT                   /translation="MTSATPSLRWKHRGELWLARWLRRWFRLRPLWLEGAPAPEFTLYS
FT                   TGAARAPAAAIPRIIWSYWQGGTPPLLVRRCFDNWRRLHPHFEIRILDERGALQYLPAI
FT                   PRALDGASAAKRADWIRLELLRRHGGIWLDASTILTRPLDWVLAEQARTGADFVGYYLQ
FT                   QYTSAPDRPVVENWFMAAPPASPFIEDLQREFTGEVIVRSGEEYIAHLRAQGLYERALQ
FT                   RIDMPAYLSMHLALQVVLLRGGAYRLCLARAEAGPYLYHVLGRWRRTGLKLRLLFARVC
FT                   GPLPPLIKLRSPDRRRLDDYLARGLYLPESVAGRWLMGDEVAR"
FT                   /protein_id="YP_004124971.1"
     MTSATPSLRW KHRGELWLAR WLRRWFRLRP LWLEGAPAPE FTLYSTGAAR APAAAIPRII        60
     WSYWQGGTPP LLVRRCFDNW RRLHPHFEIR ILDERGALQY LPAIPRALDG ASAAKRADWI       120
     RLELLRRHGG IWLDASTILT RPLDWVLAEQ ARTGADFVGY YLQQYTSAPD RPVVENWFMA       180
     APPASPFIED LQREFTGEVI VRSGEEYIAH LRAQGLYERA LQRIDMPAYL SMHLALQVVL       240
     LRGGAYRLCL ARAEAGPYLY HVLGRWRRTG LKLRLLFARV CGPLPPLIKL RSPDRRRLDD       300
     YLARGLYLPE SVAGRWLMGD EVAR                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page