(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE298

ALDEN1_2.PE298       Location/Qualifiers
FT   CDS             complement(337646..338512)
FT                   /locus_tag="Alide_0304"
FT                   /gene_family="HOG000233521" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ajs:Ajs_0189 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319761036"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102327"
FT                   /translation="MDLVALDIFRTVAAEGSVTRAAERLGRAQSNATTRVQQLEEDLGV
FT                   PLFLREGRRMRLTPEGETLLAYADRLLALAEEARQALHPGAPTGRLRIGAMESTAAARL
FT                   PGPLARLHAQWPALSLELRTAPSRQLADQVLAHQLDCALVAWPPPGLEADAPIERTPVF
FT                   AESLLLALPASHPPAATPADLRVHLLAAFAQGCTYRRIGEDWMRQGGAPVEVLELASYP
FT                   AILACVAAGRCAGVVPQSVLQLLRTPPPLRWVPLGTCDTMLLHRPGYATPALAALQSAL
FT                   LSHQDAP"
FT                   /protein_id="YP_004124973.1"
     MDLVALDIFR TVAAEGSVTR AAERLGRAQS NATTRVQQLE EDLGVPLFLR EGRRMRLTPE        60
     GETLLAYADR LLALAEEARQ ALHPGAPTGR LRIGAMESTA AARLPGPLAR LHAQWPALSL       120
     ELRTAPSRQL ADQVLAHQLD CALVAWPPPG LEADAPIERT PVFAESLLLA LPASHPPAAT       180
     PADLRVHLLA AFAQGCTYRR IGEDWMRQGG APVEVLELAS YPAILACVAA GRCAGVVPQS       240
     VLQLLRTPPP LRWVPLGTCD TMLLHRPGYA TPALAALQSA LLSHQDAP                    288
//

If you have problems or comments...

PBIL Back to PBIL home page