(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE3

ALDEN1_2.PE3         Location/Qualifiers
FT   CDS             2979..5561
FT                   /locus_tag="Alide_0003"
FT                   /gene_family="HOG000075155" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /codon_start="1"
FT                   /product="DNA gyrase, b subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein; KEGG: dia:Dtpsy_0003 DNA gyrase, B subunit; SMART:
FT                   DNA topoisomerase II; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="GI:319760741"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="GeneID:10102026"
FT                   /translation="MTDENQPDPQTTAPASVDAGGYGEGAIQILEGLEAVRKRPGMYIG
FT                   DTSDGTGLHHLVFEVVDNSIDEALAGHCDDIVVTIHTDNSISVIDNGRGIPTGVKMDDK
FT                   HEPKRSAAEIALTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSKKLRLTVRRDGKTHQ
FT                   LEFSKGVVQNRLIEVVDGFEVSPMKIVGPTEKRGTEVRFLPDTEIFKENSDFHYEILAK
FT                   RLRELSFLNNGVRIRLIDERTGKEDDFSGAGGVKGFVEFINGTKKVLHPTAFHATGARP
FT                   AESYGGIPGTEIGVEVAMQWNDGYNEQVLCFTNNIPQRDGGTHLTGLRAAMTRVIGKYI
FT                   EQNELAKKAKVDVSGDDMREGLCCVLSVKVPEPKFSSQTKDKLVSSEVRAPVEDIVAKA
FT                   LTEYLEEKPQDAKILCGKIVEAARAREAARKAREMTRRKGVLDGMGLPGKLADCQEKDP
FT                   ALCEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARYEKLLSSNEIITLITAL
FT                   GTGIGKASEDGNGKSGADDFDAAKLRYHRIIIMTDADVDGAHIRTLLLTFFYRQMPELV
FT                   ERGHIYIAQPPLYKVKNGKEELYLKDAAALDNFLLRVALNHASISTGGDAPRTLAGDEL
FT                   ATLARTHQHAERVIDRLSAFMDAEALRAAADGVAFNLDTLEDAQASAVQLQARLRELNT
FT                   SGVPADVTGEIDPRTDKPILRISRHHHGNIKSSLITQDFVAGDDYAALAEAAESFRGLI
FT                   QEGAKVMRGEGEKQKEEKISDFRQAMQWLIGEAERTTARQRYKGLGEMNPEQLWETTMD
FT                   PEVRRLLRVQIDDAIEADRVFTMLMGDEVEPRRDFIETNALRAGNIDV"
FT                   /protein_id="YP_004124678.1"
     MTDENQPDPQ TTAPASVDAG GYGEGAIQIL EGLEAVRKRP GMYIGDTSDG TGLHHLVFEV        60
     VDNSIDEALA GHCDDIVVTI HTDNSISVID NGRGIPTGVK MDDKHEPKRS AAEIALTELH       120
     AGGKFNQNSY KVSGGLHGVG VSCVNALSKK LRLTVRRDGK THQLEFSKGV VQNRLIEVVD       180
     GFEVSPMKIV GPTEKRGTEV RFLPDTEIFK ENSDFHYEIL AKRLRELSFL NNGVRIRLID       240
     ERTGKEDDFS GAGGVKGFVE FINGTKKVLH PTAFHATGAR PAESYGGIPG TEIGVEVAMQ       300
     WNDGYNEQVL CFTNNIPQRD GGTHLTGLRA AMTRVIGKYI EQNELAKKAK VDVSGDDMRE       360
     GLCCVLSVKV PEPKFSSQTK DKLVSSEVRA PVEDIVAKAL TEYLEEKPQD AKILCGKIVE       420
     AARAREAARK AREMTRRKGV LDGMGLPGKL ADCQEKDPAL CEIYIVEGDS AGGSAKQGRD       480
     RKFQAILPLR GKILNVEKAR YEKLLSSNEI ITLITALGTG IGKASEDGNG KSGADDFDAA       540
     KLRYHRIIIM TDADVDGAHI RTLLLTFFYR QMPELVERGH IYIAQPPLYK VKNGKEELYL       600
     KDAAALDNFL LRVALNHASI STGGDAPRTL AGDELATLAR THQHAERVID RLSAFMDAEA       660
     LRAAADGVAF NLDTLEDAQA SAVQLQARLR ELNTSGVPAD VTGEIDPRTD KPILRISRHH       720
     HGNIKSSLIT QDFVAGDDYA ALAEAAESFR GLIQEGAKVM RGEGEKQKEE KISDFRQAMQ       780
     WLIGEAERTT ARQRYKGLGE MNPEQLWETT MDPEVRRLLR VQIDDAIEAD RVFTMLMGDE       840
     VEPRRDFIET NALRAGNIDV                                                   860
//

If you have problems or comments...

PBIL Back to PBIL home page