(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE30

ALDEN1_2.PE30        Location/Qualifiers
FT   CDS             complement(38152..38745)
FT                   /locus_tag="Alide_0030"
FT                   /gene_family="HOG000220307" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0007"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0007 hypothetical protein"
FT                   /db_xref="GI:319760768"
FT                   /db_xref="GeneID:10102053"
FT                   /translation="MTRFKITQRLACTALAAALAGMAIPSMAQPAPGAGPTAEQAQRQG
FT                   PRAMTPEQRQQFMLQRAEAFKQKLQLTPAQEPAWNTFMQSMRPDAGSRKAWLEMKDMDK
FT                   LTTPERIDRMRAIRAQRAAEMDRRGDAVKAFYATLTPAQQKTFDAEGTRMYGRRGAQWD
FT                   RHMGDHKGDWRGPRNGMHRHGPGPMPAPGAPAAQ"
FT                   /protein_id="YP_004124705.1"
     MTRFKITQRL ACTALAAALA GMAIPSMAQP APGAGPTAEQ AQRQGPRAMT PEQRQQFMLQ        60
     RAEAFKQKLQ LTPAQEPAWN TFMQSMRPDA GSRKAWLEMK DMDKLTTPER IDRMRAIRAQ       120
     RAAEMDRRGD AVKAFYATLT PAQQKTFDAE GTRMYGRRGA QWDRHMGDHK GDWRGPRNGM       180
     HRHGPGPMPA PGAPAAQ                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page