(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE300

ALDEN1_2.PE300       Location/Qualifiers
FT   CDS             complement(339801..340520)
FT                   /locus_tag="Alide_0306"
FT                   /gene_family="HOG000051122" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /codon_start="1"
FT                   /product="mosc domain containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   dia:Dtpsy_0210 MOSC domain containing protein"
FT                   /db_xref="GI:319761038"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="GeneID:10102329"
FT                   /translation="MNATPPQPLGRLRAVLTGRALPYTRPGSRSAIAKQARGGPVGAGP
FT                   LGLDGDEQGDPRVHGGPDKAVHCYAWAQYAPWRQELAGNAAAQALLEQPGAFGENFSLD
FT                   DLQESQVCIADQWQIGSARFEVSQGRQPCWKLNDRFGVPDMALRVQSSLRTGWYLRVLQ
FT                   GGQVQAGDQVWLLARPYPEWPITRLLRAIAERDCTPATLRQILALPLPPSWHKLFSCRL
FT                   ENASAEDWTSRLVGRQP"
FT                   /protein_id="YP_004124975.1"
     MNATPPQPLG RLRAVLTGRA LPYTRPGSRS AIAKQARGGP VGAGPLGLDG DEQGDPRVHG        60
     GPDKAVHCYA WAQYAPWRQE LAGNAAAQAL LEQPGAFGEN FSLDDLQESQ VCIADQWQIG       120
     SARFEVSQGR QPCWKLNDRF GVPDMALRVQ SSLRTGWYLR VLQGGQVQAG DQVWLLARPY       180
     PEWPITRLLR AIAERDCTPA TLRQILALPL PPSWHKLFSC RLENASAEDW TSRLVGRQP        239
//

If you have problems or comments...

PBIL Back to PBIL home page