(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE301

ALDEN1_2.PE301       Location/Qualifiers
FT   CDS             complement(340517..341077)
FT                   /locus_tag="Alide_0307"
FT                   /gene_family="HOG000223522" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /codon_start="1"
FT                   /product="alkyl hydroperoxide reductase/ thiol specific
FT                   antioxidant/ mal allergen"
FT                   /transl_table="11"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: dia:Dtpsy_0211 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="GI:319761039"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="GeneID:10102330"
FT                   /translation="MNGTYHPPAPPLQVAQWFNTPQPLTLKALRGRVVVLHAFQMLCPG
FT                   CVEHGIPQARRVHEAFPQDRLVVIGLHTVFEHHDVQGGAAALQAFMHEYRLRFPIGLDQ
FT                   PDPQRTIPRTMHSLALQGTPSLVVLDPQGRVRLHHFGHLDDLRLGTLLGQLLAEPVPAA
FT                   ATPAQAAAGCDDNGCPRPDMPPP"
FT                   /protein_id="YP_004124976.1"
     MNGTYHPPAP PLQVAQWFNT PQPLTLKALR GRVVVLHAFQ MLCPGCVEHG IPQARRVHEA        60
     FPQDRLVVIG LHTVFEHHDV QGGAAALQAF MHEYRLRFPI GLDQPDPQRT IPRTMHSLAL       120
     QGTPSLVVLD PQGRVRLHHF GHLDDLRLGT LLGQLLAEPV PAAATPAQAA AGCDDNGCPR       180
     PDMPPP                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page