(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE302

ALDEN1_2.PE302       Location/Qualifiers
FT   CDS             complement(341096..341590)
FT                   /locus_tag="Alide_0308"
FT                   /gene_family="HOG000225989" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /codon_start="1"
FT                   /product="activator of hsp90 atpase 1 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: oca:OCAR_5014 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="GI:319761040"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="GeneID:10102331"
FT                   /translation="MSTADIGTLQRTATGFEGRLTRRLDHGADAVWRMLTDPQAMAQWL
FT                   APGNIELCTGGAVRIDFVDSGIVIDSRVTAFEAQRVLAYSWSSGNEPERPMRWELAPAG
FT                   EGTALTLTLQIPAGEDAAKACAGFEGHLDMLAAALEGVPIKFPFERFLQARSAYNAQLA
FT                   G"
FT                   /protein_id="YP_004124977.1"
     MSTADIGTLQ RTATGFEGRL TRRLDHGADA VWRMLTDPQA MAQWLAPGNI ELCTGGAVRI        60
     DFVDSGIVID SRVTAFEAQR VLAYSWSSGN EPERPMRWEL APAGEGTALT LTLQIPAGED       120
     AAKACAGFEG HLDMLAAALE GVPIKFPFER FLQARSAYNA QLAG                        164
//

If you have problems or comments...

PBIL Back to PBIL home page