(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE303

ALDEN1_2.PE303       Location/Qualifiers
FT   CDS             complement(341690..342151)
FT                   /locus_tag="Alide_0309"
FT                   /gene_family="HOG000242268" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /codon_start="1"
FT                   /product="maoc domain protein dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   dac:Daci_0013 dehydratase"
FT                   /db_xref="GI:319761041"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:10102332"
FT                   /translation="MIKHQMCPQRYFEDFELGEQFLLPSRTMTDALFAAFQLASGDNHP
FT                   VHYDVEYCRAHGMPHMLAHGYQVVIQTAAGAGLFPHMVEESLKGFLEQGSRFLNPVFVG
FT                   DTLYCTLTVSELRPGNTTGVITLGTEVKNQKGEVVMDGFQKYLLRKRRP"
FT                   /protein_id="YP_004124978.1"
     MIKHQMCPQR YFEDFELGEQ FLLPSRTMTD ALFAAFQLAS GDNHPVHYDV EYCRAHGMPH        60
     MLAHGYQVVI QTAAGAGLFP HMVEESLKGF LEQGSRFLNP VFVGDTLYCT LTVSELRPGN       120
     TTGVITLGTE VKNQKGEVVM DGFQKYLLRK RRP                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page