(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE304

ALDEN1_2.PE304       Location/Qualifiers
FT   CDS             complement(342173..343144)
FT                   /locus_tag="Alide_0310"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_0012"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_0012 hypothetical protein"
FT                   /db_xref="GI:319761042"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102333"
FT                   /translation="MMTRRSIHTAIVGALALVSAAAHAQSYPARPVKLIVPYAAGGPTD
FT                   TFARALADAWGKKLGQVLVVENRTGAGTLVGTDAVAKAQPDGYTILLTTVAHAVNPSIH
FT                   DKMPYRTVEDFAPVGMAAKAPLVIVVNKNFPAQNLQEFIGYIKDHPGKVNYGSAGVGSA
FT                   PHLGVELLNYMTGSKTEHVPYRGSAPAMQDVIGGHLAFMMDSAPTGLAQVKAGTVRLIA
FT                   TTMGQRLPQTPDTPAVAEVVPKYEAYTWNAVFAPAQTPAPVIAKLNTSLKEALQDPGLQ
FT                   KQAYDMGLVLEKNPQPQALAAFLGGELAKWGQVAKAAKMTAN"
FT                   /protein_id="YP_004124979.1"
     MMTRRSIHTA IVGALALVSA AAHAQSYPAR PVKLIVPYAA GGPTDTFARA LADAWGKKLG        60
     QVLVVENRTG AGTLVGTDAV AKAQPDGYTI LLTTVAHAVN PSIHDKMPYR TVEDFAPVGM       120
     AAKAPLVIVV NKNFPAQNLQ EFIGYIKDHP GKVNYGSAGV GSAPHLGVEL LNYMTGSKTE       180
     HVPYRGSAPA MQDVIGGHLA FMMDSAPTGL AQVKAGTVRL IATTMGQRLP QTPDTPAVAE       240
     VVPKYEAYTW NAVFAPAQTP APVIAKLNTS LKEALQDPGL QKQAYDMGLV LEKNPQPQAL       300
     AAFLGGELAK WGQVAKAAKM TAN                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page