(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE309

ALDEN1_2.PE309       Location/Qualifiers
FT   CDS             complement(347563..348921)
FT                   /locus_tag="Alide_0315"
FT                   /gene_family="HOG000217209" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily mfs_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dia:Dtpsy_0214 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:319761047"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:10102338"
FT                   /translation="MVAVRIIPRMPDSSSAAPARRSWRQAWLVYLEPASLRMLALGFSA
FT                   GLPLLLVLGTLSFRLREAGIDRTTIGYLSWVGLAYAFKWVWSPLVDRLPLPLLTRALGR
FT                   RRSWLLLAQGMVMAGLVGMALVDPRATLGPMVWCALLVAFGSATQDIALDAFRIESADA
FT                   DRQAALAATYQTGYRLAMIWAGAGVLWVAARAEVAGLAGYQAGAWAAAYLVMAASMLVG
FT                   TATVLLSPEPTPRPLAPARNLGEWLRGAVVEPFADFIRRYRWQAALILALIAVYRISDV
FT                   VMGIMANPFYVDMGYTKDEVAAVTKVFGVVMTLAGAFVGGVLSMRLGVMRVLMLGAVLS
FT                   ALSNLLFAWLGQRGHDLTGLVLVVSADNLAGGIASAAFIAYLSGLTNVQYSATQYALFS
FT                   SMMLLLPKWLAGFSGRFVDAHGYAAFFTGTALLGLPVLLLVALAARAKTASSV"
FT                   /protein_id="YP_004124984.1"
     MVAVRIIPRM PDSSSAAPAR RSWRQAWLVY LEPASLRMLA LGFSAGLPLL LVLGTLSFRL        60
     REAGIDRTTI GYLSWVGLAY AFKWVWSPLV DRLPLPLLTR ALGRRRSWLL LAQGMVMAGL       120
     VGMALVDPRA TLGPMVWCAL LVAFGSATQD IALDAFRIES ADADRQAALA ATYQTGYRLA       180
     MIWAGAGVLW VAARAEVAGL AGYQAGAWAA AYLVMAASML VGTATVLLSP EPTPRPLAPA       240
     RNLGEWLRGA VVEPFADFIR RYRWQAALIL ALIAVYRISD VVMGIMANPF YVDMGYTKDE       300
     VAAVTKVFGV VMTLAGAFVG GVLSMRLGVM RVLMLGAVLS ALSNLLFAWL GQRGHDLTGL       360
     VLVVSADNLA GGIASAAFIA YLSGLTNVQY SATQYALFSS MMLLLPKWLA GFSGRFVDAH       420
     GYAAFFTGTA LLGLPVLLLV ALAARAKTAS SV                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page