(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE31

ALDEN1_2.PE31        Location/Qualifiers
FT   CDS             38962..39903
FT                   /locus_tag="Alide_0031"
FT                   /gene_family="HOG000117544" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04381"
FT                   /codon_start="1"
FT                   /product="exonuclease rdgc"
FT                   /transl_table="11"
FT                   /note="PFAM: exonuclease RdgC; KEGG: ajs:Ajs_0008
FT                   recombination associated protein"
FT                   /db_xref="GI:319760769"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="GeneID:10102054"
FT                   /translation="MFKNIIVYRIAPEWHAELTQLEEALAKAPFQECGATQEKSSGWVP
FT                   PRGEAHGLLAESVGGQWILRFMTESKMLPGTVLARKVKEKAAQIEQQTGRKPGKKETRE
FT                   LKDEAKLDLLPMAFTKQGSTWVWVDCEARLLVLDTGVQGRADEIVTALVEALPGLSVAL
FT                   VDTQTSPQAAMAHWLKEQEPPAGFSIDRECELKAADESKAVVRYARHPLDIEEVQAHIQ
FT                   AGKLPTKLAMTWDDRVSFVLTEGLQLKKLAFLDTVFEGQPQDDGGFDADVAIATGELSK
FT                   LIPDLIEALGGEGRTELGSPAQPPQDDGGAPF"
FT                   /protein_id="YP_004124706.1"
     MFKNIIVYRI APEWHAELTQ LEEALAKAPF QECGATQEKS SGWVPPRGEA HGLLAESVGG        60
     QWILRFMTES KMLPGTVLAR KVKEKAAQIE QQTGRKPGKK ETRELKDEAK LDLLPMAFTK       120
     QGSTWVWVDC EARLLVLDTG VQGRADEIVT ALVEALPGLS VALVDTQTSP QAAMAHWLKE       180
     QEPPAGFSID RECELKAADE SKAVVRYARH PLDIEEVQAH IQAGKLPTKL AMTWDDRVSF       240
     VLTEGLQLKK LAFLDTVFEG QPQDDGGFDA DVAIATGELS KLIPDLIEAL GGEGRTELGS       300
     PAQPPQDDGG APF                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page