(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE310

ALDEN1_2.PE310       Location/Qualifiers
FT   CDS             348931..349596
FT                   /locus_tag="Alide_0316"
FT                   /gene_family="HOG000154776" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0215 transcriptional regulator, AraC
FT                   family; PFAM: Cupin 2 conserved barrel domain protein;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:319761048"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="GeneID:10102339"
FT                   /translation="MPSLVHPVASVRRYAGEHQAHAHEHAQVLYALEGRMELEVAGRAA
FT                   FVDTACGLVVPAGVEHGFLARPGTRMFVIDAPPQAGVDRVRRFAVPPGARPADAAGQLA
FT                   LLLHAPRVLARRGMDLALLQSRVDAALHEPWPTARMAALFHLSAPRFHARLVELTGRTP
FT                   QAWLRARRLDAAERALARGLPLEATALRVGYASASALAYALRRERGTGARALRGFQAK"
FT                   /protein_id="YP_004124985.1"
     MPSLVHPVAS VRRYAGEHQA HAHEHAQVLY ALEGRMELEV AGRAAFVDTA CGLVVPAGVE        60
     HGFLARPGTR MFVIDAPPQA GVDRVRRFAV PPGARPADAA GQLALLLHAP RVLARRGMDL       120
     ALLQSRVDAA LHEPWPTARM AALFHLSAPR FHARLVELTG RTPQAWLRAR RLDAAERALA       180
     RGLPLEATAL RVGYASASAL AYALRRERGT GARALRGFQA K                           221
//

If you have problems or comments...

PBIL Back to PBIL home page