(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE314

ALDEN1_2.PE314       Location/Qualifiers
FT   CDS             complement(352768..354474)
FT                   /locus_tag="Alide_0322"
FT                   /gene_family="HOG000058487" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /codon_start="1"
FT                   /product="sigma-54 factor interaction domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: lch:Lcho_3364 sigma54 specific transcriptional
FT                   regulator; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; Activator of aromatic
FT                   catabolism; 4-vinyl reductase 4VR; helix-turn-helix
FT                   Fis-type; SMART: AAA ATPase"
FT                   /db_xref="GI:319761052"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008134"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR020441"
FT                   /db_xref="GeneID:10102345"
FT                   /translation="MPTLPALPSDADLRRQIQFSAADGRIWLAGQRMVLMHAASLGILR
FT                   RELIHTLGPAATRRLLLRVGYASGERDAALARQLRPGADAFAMFSVGPQLHMLQGAVQV
FT                   TPEKLELDAATGHFHGIFAWQQSWEVEVHVRDFGPQNVPVCWMLLGYASGYTSAFMGRT
FT                   VLYKEVQCAASGHAHCRIEGRPVQDWPDGAQLAADYAPDALLDDGAPQNGPRALPAWPA
FT                   PMPAEDRPEPPADALGPLIGRSAGFTAATRLLRKAAGTQVTVLLTGETGVGKERFARAL
FT                   HALSPRAAKPFVAVNCAALPGNLVESELFGTEKGAYTGADAARAGRFERAHGGTLFLDE
FT                   LGELPLSAQAKLLRVLQDGQVERLGATQPRQVDVRLVAATHVDLQDAVRAGRFRQDLYY
FT                   RLNVYPIRIPPLRERQDDIEPFARHLLQRFAALHDKHIGGLTDRALHALRQYAWPGNVR
FT                   EMENLIERGVILADPGQPVDAAHLFPDSAPAAAPAHTLQASGRLGEARAPACDAALIDR
FT                   LLGERLDLQALETHLIEAAVERSHGNLAAAARLLGLTRPQLSYRLNKVRDI"
FT                   /protein_id="YP_004124989.1"
     MPTLPALPSD ADLRRQIQFS AADGRIWLAG QRMVLMHAAS LGILRRELIH TLGPAATRRL        60
     LLRVGYASGE RDAALARQLR PGADAFAMFS VGPQLHMLQG AVQVTPEKLE LDAATGHFHG       120
     IFAWQQSWEV EVHVRDFGPQ NVPVCWMLLG YASGYTSAFM GRTVLYKEVQ CAASGHAHCR       180
     IEGRPVQDWP DGAQLAADYA PDALLDDGAP QNGPRALPAW PAPMPAEDRP EPPADALGPL       240
     IGRSAGFTAA TRLLRKAAGT QVTVLLTGET GVGKERFARA LHALSPRAAK PFVAVNCAAL       300
     PGNLVESELF GTEKGAYTGA DAARAGRFER AHGGTLFLDE LGELPLSAQA KLLRVLQDGQ       360
     VERLGATQPR QVDVRLVAAT HVDLQDAVRA GRFRQDLYYR LNVYPIRIPP LRERQDDIEP       420
     FARHLLQRFA ALHDKHIGGL TDRALHALRQ YAWPGNVREM ENLIERGVIL ADPGQPVDAA       480
     HLFPDSAPAA APAHTLQASG RLGEARAPAC DAALIDRLLG ERLDLQALET HLIEAAVERS       540
     HGNLAAAARL LGLTRPQLSY RLNKVRDI                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page