(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE317

ALDEN1_2.PE317       Location/Qualifiers
FT   CDS             356076..356345
FT                   /locus_tag="Alide_0325"
FT                   /gene_family="HOG000219897" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02406"
FT                   /codon_start="1"
FT                   /product="monooxygenase component mmob/dmpm"
FT                   /transl_table="11"
FT                   /note="PFAM: monooxygenase component MmoB/DmpM; KEGG:
FT                   azo:azo2442 phenol hydrolase, subunit P2"
FT                   /db_xref="GI:319761055"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="InterPro:IPR003454"
FT                   /db_xref="GeneID:10102348"
FT                   /translation="MSNVFIAFQKNEETRAIVDAIVADNPQAIVNQQPAMVKIDAPGRL
FT                   VIRKSSIEQEIGREFDLQEMHVHLITLSGNIDETDDELSLTWNQ"
FT                   /protein_id="YP_004124992.1"
     MSNVFIAFQK NEETRAIVDA IVADNPQAIV NQQPAMVKID APGRLVIRKS SIEQEIGREF        60
     DLQEMHVHLI TLSGNIDETD DELSLTWNQ                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page