(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE318

ALDEN1_2.PE318       Location/Qualifiers
FT   CDS             356371..357918
FT                   /locus_tag="Alide_0326"
FT                   /gene_family="HOG000219898" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02332"
FT                   /codon_start="1"
FT                   /product="methane/phenol/toluene hydroxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: methane/phenol/toluene hydroxylase; YHS
FT                   domain-containing protein; KEGG: azo:azo2441 phenol
FT                   hydroxylase, subunit P3"
FT                   /db_xref="GI:319761056"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="GeneID:10102349"
FT                   /translation="MDRQVSKKLGLKERYNLMTRDLAWTPTYQALKDVFPYMEYEGIKI
FT                   HDWDKFEDPFRMTMDSYWKYQAEKERKLYAIIDAFTQNNGHLGVTDARYINALKLFLTG
FT                   VSPLEYMAHRGFAHVGRQYPGAGPRVACLMQSLDEIRHSQTQIHSLSNYNKHYNGFANW
FT                   RHQHDRVWYLSVPKSFFDDAVSAGPFEFIVAIGFAFEYVLTNLLFVPFISGAAYNGDMG
FT                   AMAFGFSAQSDESRHMTLGLEIIKFILEQDPDNLPIVQAWLDKWFWRGYRVLTLVAMMM
FT                   DYMLPKRVMSWKEAWETYAEQNGGALFADLARYGIKVPAGWEQACKDKDHLSHQAWNVF
FT                   YNYGAAAPFHTWAPSEADMKWLSEKYPDTFDKYYRPVWEHYAKEQAEGRRFYNKTLPML
FT                   CQTCQIPMFFTEPGDPTKIAYRESDWRGQKYHFCSDGCKHIFDNEPEKYVQSWLPVHQI
FT                   YQGNCFPEDADPSKPDFDPLMEVLRWYRMEFGRDNLDYADSEDKKNFEAWRAQSTSN"
FT                   /protein_id="YP_004124993.1"
     MDRQVSKKLG LKERYNLMTR DLAWTPTYQA LKDVFPYMEY EGIKIHDWDK FEDPFRMTMD        60
     SYWKYQAEKE RKLYAIIDAF TQNNGHLGVT DARYINALKL FLTGVSPLEY MAHRGFAHVG       120
     RQYPGAGPRV ACLMQSLDEI RHSQTQIHSL SNYNKHYNGF ANWRHQHDRV WYLSVPKSFF       180
     DDAVSAGPFE FIVAIGFAFE YVLTNLLFVP FISGAAYNGD MGAMAFGFSA QSDESRHMTL       240
     GLEIIKFILE QDPDNLPIVQ AWLDKWFWRG YRVLTLVAMM MDYMLPKRVM SWKEAWETYA       300
     EQNGGALFAD LARYGIKVPA GWEQACKDKD HLSHQAWNVF YNYGAAAPFH TWAPSEADMK       360
     WLSEKYPDTF DKYYRPVWEH YAKEQAEGRR FYNKTLPMLC QTCQIPMFFT EPGDPTKIAY       420
     RESDWRGQKY HFCSDGCKHI FDNEPEKYVQ SWLPVHQIYQ GNCFPEDADP SKPDFDPLME       480
     VLRWYRMEFG RDNLDYADSE DKKNFEAWRA QSTSN                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page